p114RhoGEF Recombinant Protein Antigen

Images

 
There are currently no images for p114RhoGEF Protein (NBP1-92238PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

p114RhoGEF Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ARHGEF18.

Source: E. coli

Amino Acid Sequence: RYPTHFLSTNSVLASVTASLKEHPRGTLLSDGSPALSRNVGMTVSQKGGPQPTPSPAGPGTQLGPITGEMDEADSAFLKFKQTADDSLSLTSPNTESI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ARHGEF18
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-92238.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for p114RhoGEF Recombinant Protein Antigen

  • 114 kDa Rho-specific guanine nucleotide exchange factor
  • EC 3.4.24
  • EC 3.6.1
  • KIAA0521rho guanine nucleotide exchange factor 18
  • MGC15913
  • p114RhoGEF
  • P114-RhoGEF
  • P114-RHO-GEF
  • Rho/Rac guanine nucleotide exchange factor (GEF) 18
  • Rho/Rac guanine nucleotide exchange factor 18
  • Rho-specific guanine nucleotide exchange factor p114
  • SA-RhoGEF
  • Septin-associated RhoGEF

Background

Rho GTPases are GTP binding proteins that regulate a wide spectrum of cellular functions. These cellular processes include cytoskeletal rearrangements, gene transcription, cell growth and motility. Activation of Rho GTPases is under the direct control of guanine nucleotide exchange factors (GEFs). The protein encoded by this gene is a guanine nucleotide exchange factor and belongs to the Rho GTPase GFE family. Family members share a common feature, a Dbl (DH) homology domain followed by a pleckstrin (PH) homology domain. Alternatively spliced transcript variants encoding different isoforms have been identified. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-21577
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, WB
NB100-91273
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-58359
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
H00056731-M02
Species: Hu
Applications: ELISA, ICC/IF, WB
MAB4470
Species: All-Multi
Applications: Flow, ICC, IHC, WB
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF6260
Species: Hu
Applications: WB
NB110-68800
Species: Hu, Mu, Pm
Applications: ICC/IF, WB
NBP2-67895
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, IP, WB
NB100-1354
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-32728
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
H00005962-M06
Species: Ch, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
NBP1-85047
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-92238PEP
Species: Hu
Applications: AC

Publications for p114RhoGEF Protein (NBP1-92238PEP) (0)

There are no publications for p114RhoGEF Protein (NBP1-92238PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for p114RhoGEF Protein (NBP1-92238PEP) (0)

There are no reviews for p114RhoGEF Protein (NBP1-92238PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for p114RhoGEF Protein (NBP1-92238PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional p114RhoGEF Products

Research Areas for p114RhoGEF Protein (NBP1-92238PEP)

Find related products by research area.

Blogs on p114RhoGEF

There are no specific blogs for p114RhoGEF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our p114RhoGEF Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ARHGEF18