OTX3 Antibody (1A9)

• Reactivity: Hu
• Applications: ELISA
• Clone: 1A9
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

OTX3 Antibody (1A9) Summary

• Immunogen: DMBX1 (NP_671725, 1 a.a. ~ 88 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MQHYGVNGYSLHAMNSLSAMYNLHQQAAQQAQHAPDYRPSVHALTLAERLAGCTFQDIILEARYGSQHRKQRRSRTAFTAQQLEALEK
• Specificity: DMBX1 - diencephalon/mesencephalon homeobox 1
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: DMBX1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
• Application Notes: Antibody reactive against recombinant protein on ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for OTX3 Antibody (1A9)

• diencephalon/mesencephalon homeobox 1
• diencephalon/mesencephalon homeobox protein 1
• homeoprotein MBX
• MBX
• Orthodenticle homolog 3
• OTX3
• Paired-like homeobox protein DMBX1
• PAXBorthodenticle homolog 3 (Drosophila)

Background

This gene encodes a member of the bicoid sub-family of homeodomain-containing transcription factors. The encoded protein acts as a transcription factor and may play a role in brain and sensory organ development. Two transcript variants encoding distinct isoforms have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DMBX1
• Entrez:
  • 127343(Human)
• OMIM:
  • 607410(Human)
• Uniprot:
  • NP_671725(Human)