OTX3 Antibody (1A9)

Images

 
There are currently no images for OTX3 Antibody (H00127343-M01).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
1A9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

OTX3 Antibody (1A9) Summary

Immunogen
DMBX1 (NP_671725, 1 a.a. ~ 88 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MQHYGVNGYSLHAMNSLSAMYNLHQQAAQQAQHAPDYRPSVHALTLAERLAGCTFQDIILEARYGSQHRKQRRSRTAFTAQQLEALEK
Specificity
DMBX1 - diencephalon/mesencephalon homeobox 1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
DMBX1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
Antibody reactive against recombinant protein on ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for OTX3 Antibody (1A9)

  • diencephalon/mesencephalon homeobox 1
  • diencephalon/mesencephalon homeobox protein 1
  • homeoprotein MBX
  • MBX
  • Orthodenticle homolog 3
  • OTX3
  • Paired-like homeobox protein DMBX1
  • PAXBorthodenticle homolog 3 (Drosophila)

Background

This gene encodes a member of the bicoid sub-family of homeodomain-containing transcription factors. The encoded protein acts as a transcription factor and may play a role in brain and sensory organ development. Two transcript variants encoding distinct isoforms have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for OTX3 Antibody (H00127343-M01) (0)

There are no publications for OTX3 Antibody (H00127343-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OTX3 Antibody (H00127343-M01) (0)

There are no reviews for OTX3 Antibody (H00127343-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for OTX3 Antibody (H00127343-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional OTX3 Products

Research Areas for OTX3 Antibody (H00127343-M01)

Find related products by research area.

Blogs on OTX3

There are no specific blogs for OTX3, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OTX3 Antibody (1A9) and receive a gift card or discount.

Bioinformatics

Gene Symbol DMBX1
Entrez
OMIM
Uniprot