Otubain-1 Recombinant Protein Antigen

Images

 
There are currently no images for Otubain-1 Protein (NBP1-83670PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Otubain-1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human OTUB1.

Source: E. coli

Amino Acid Sequence: AAEEPQQQKQEPLGSDSEGVNCLAYDEAIMAQQDRIQQEIAVQNPLVSERLELSVLYKEYAEDDNIYQQKIKDLHKKYSYIRKTRPD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
OTUB1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83670. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Otubain-1 Recombinant Protein Antigen

  • Deubiquitinating enzyme OTUB1
  • EC 3.1.2
  • EC 3.4.19.12
  • FLJ20113
  • FLJ40710
  • hOTU1
  • MGC111158
  • OTB1
  • OTB1MGC4584
  • OTU domain, ubiquitin aldehyde binding 1
  • OTU domain-containing ubiquitin aldehyde-binding protein 1
  • OTU1
  • OTU1OTU-domain Ubal-binding 1
  • OTUB1
  • Otubain1
  • Otubain-1
  • ubiquitin thioesterase OTUB1
  • ubiquitin-specific protease otubain 1
  • Ubiquitin-specific-processing protease OTUB1

Background

The product of this gene is a member of the OTU (ovarian tumor) superfamily of predicted cysteine proteases. The encoded protein is a highly specific ubiquitin iso-peptidase, and cleaves ubiquitin from branched poly-ubiquitin chains but not from ubiquitinated substrates. It interacts with another ubiquitin protease and an E3 ubiquitin ligase that inhibits cytokine gene transcription in the immune system. It is proposed to function in specific ubiquitin-dependent pathways, possibly by providing an editing function for polyubiquitin chain growth. Alternative splicing results in multiple transcript variants.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-16793
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-57183
Species: Hu
Applications: ICC/IF, WB
AF7217
Species: Hu, Mu
Applications: ICC, WB
NBP2-01109
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-89150
Species: Hu, Rt
Applications: IHC, IHC-P, WB
H00011026-M01
Species: Hu
Applications: ELISA, WB
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
NBP2-03223
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, WB
202-IL
Species: Hu
Applications: BA
NBP2-21037
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP2-24610
Species: Ca, Eq, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-31361
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
AF143
Species: Hu
Applications: IHC, Simple Western, WB
NB600-1335
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
NBP1-83670PEP
Species: Hu
Applications: AC

Publications for Otubain-1 Protein (NBP1-83670PEP) (0)

There are no publications for Otubain-1 Protein (NBP1-83670PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Otubain-1 Protein (NBP1-83670PEP) (0)

There are no reviews for Otubain-1 Protein (NBP1-83670PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Otubain-1 Protein (NBP1-83670PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Otubain-1 Products

Blogs on Otubain-1

There are no specific blogs for Otubain-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Otubain-1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol OTUB1