OSBP1 Antibody (5A3) - Azide and BSA Free

Western Blot: OSBP1 Antibody (5A3) [H00005007-M01-100ug] - Detection against Immunogen (34.98 KDa) .

Western Blot: OSBP1 Antibody (5A3) [H00005007-M01-100ug] - OSBP monoclonal antibody (M01), clone 5A3. Western Blot analysis of OSBP expression in Jurkat.

ELISA: OSBP1 Antibody (5A3) [H00005007-M01-100ug] - Detection limit for recombinant GST tagged OSBP is 0.03 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 5A3
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

OSBP1 Antibody (5A3) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse OSBP1 Antibody (5A3) - Azide and BSA Free (H00005007-M01-100ug) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: OSBP (NP_002547.1, 324 a.a. ~ 407 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GATVLPANTPGNVGSGKDQCCSGKGDMSDEDDENEFFDAPEIITMPENLGHKRTGSNISGASSDISLDEQYKHQLEETKKEKRT
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: OSBP
• Purity: Protein A or G purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A or G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for OSBP1 Antibody (5A3) - Azide and BSA Free

• OSBP1oxysterol-binding protein 1
• oxysterol binding protein

Background

Oxysterol binding protein is an intracellular protein that is believed to transport sterols from lysosomes to the nucleus where the sterol down-regulates the genes for the LDL receptor, HMG-CoA reductase, and HMG synthetase.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: OSBP
• Entrez:
  • 5007(Human)
• OMIM:
  • 167040(Human)
• Uniprot:
  • NP_002547.1(Human)