OS9 Recombinant Protein Antigen

Images

 
There are currently no images for OS9 Protein (NBP1-84803PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

OS9 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human OS9.

Source: E. coli

Amino Acid Sequence: PLSCSYVLTIRTPRLCPHPLLRPPPSAAPQAILCHPSLQPEEYMAYVQRQADSKQYGDKIIEELQDLGPQVWSETKSGVAPQKMAGASPTKDDSKDSDFWKML

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
OS9
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84803.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for OS9 Recombinant Protein Antigen

  • Amplified in osteosarcoma 9
  • endoplasmic reticulum lectin 2
  • ERLEC2
  • erlectin 2
  • OS-9
  • osteosarcoma amplified 9, endoplasmic reticulum associated protein
  • osteosarcoma amplified 9, endoplasmic reticulum lectin
  • protein OS-9

Background

OS9 is a lectin which functions in endoplasmic reticulum quality control and ER-associated degradation. This ER glycoprotein is found in the intralumenal level and highly expressed in tumor tissue. The OS9 gene is transcriptionally induced upon activation of the Ire1/Xbp1 ER-stress pathway.

Functionally, OS9 binds to HIF-1, a key regulator of the hypoxic response and angiogenesis, and promotes the degradation of one of its subunits. It may also bind terminally misfolded non-glycosylated proteins as well as improperly folded glycoproteins, retain them in the ER, and possibly transfer them to the ubiquitination machinery and promote their degradation. One such possible target includes TRPV4.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86801
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-93746
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB100-2526
Species: Ha, Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, KO, WB
NB100-105
Species: Bv, Ca, Fe, Ma, Hu, Pm, Mu, Po, Pm, Rb, Rt, Sh, Xp
Applications: ChIP, ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, In vitro, KD, KO, LA, PLA, Simple Western, TCS, WB
NBP1-31308
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
H00009695-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP1-06274
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC,  IHC-P, Simple Western, WB
NB300-619
Species: Bv, Ch, Ha, Hu, Mu, Rt
Applications: ICC, ICC/IF, IHC,  IHC-P, IP, WB
AF1543
Species: Hu
Applications: IHC, WB
H00054431-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB100-137
Species: Hu, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, KD, KO, Simple Western, WB
NBP2-45411
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
DVE00
Species: Hu
Applications: ELISA
NB100-2331
Species: Am, Ca, Fi, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, ChIP, ELISA, Flow, IB, ICC/IF, IHC-WhMt, IHC, IHC-Fr,  IHC-P, IP, Simple Western, SB, WB
NBP2-21037
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-67232
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
MAB7824
Species: Hu
Applications: CyTOF-ready, Flow
NBP2-31361
Species: Hu
Applications: IHC,  IHC-P, WB

Publications for OS9 Protein (NBP1-84803PEP) (0)

There are no publications for OS9 Protein (NBP1-84803PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OS9 Protein (NBP1-84803PEP) (0)

There are no reviews for OS9 Protein (NBP1-84803PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for OS9 Protein (NBP1-84803PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional OS9 Products

Research Areas for OS9 Protein (NBP1-84803PEP)

Find related products by research area.

Blogs on OS9.

OS9: Taking proteins to the ER finish line
The OS9 protein is a lectin/glycoprotein that maintains endoplasmic reticulum (ER) quality control and ER-associated degradation (the so-called ERAD pathway) of newly synthesized proteins. It is essential for the recognition of terminally misfolded no...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our OS9 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol OS9