ORAI3 Recombinant Protein Antigen

Images

 
There are currently no images for ORAI3 Protein (NBP1-93523PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ORAI3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ORAI3.

Source: E.coli

Amino Acid Sequence: APLDTPTPMVPTSRVPGTLAPVATSLSPASNLPRSSASAAPSQAEPACPPRQACGGGGAHGPGWQA

Protein/Peptide Type
Recombinant Protein Antigen
Gene
ORAI3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-93523.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related protocol, click here.
Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ORAI3 Recombinant Protein Antigen

  • ORAI calcium release-activated calcium modulator 3
  • TMEM142C

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-75522
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00006786-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-77283
Species: Hu, Mu
Applications: WB, ELISA, ICC, IF
NBP1-76791
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-98844
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
AF636
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-56929
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-58719
Species: Hu
Applications: WB, ICC/IF
NBP2-12905
Species: Rt
Applications: WB, ICC/IF, IHC, IP
NBP2-33694
Species: Hu
Applications: IHC, IHC-P
NBP1-00142
Species: Hu, Mu
Applications: WB, IP, PEP-ELISA
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
640-A3
Species: Mu
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56483
Species: Hu
Applications: ICC/IF
NB110-81601
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP1-70352
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IF

Publications for ORAI3 Protein (NBP1-93523PEP) (0)

There are no publications for ORAI3 Protein (NBP1-93523PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ORAI3 Protein (NBP1-93523PEP) (0)

There are no reviews for ORAI3 Protein (NBP1-93523PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for ORAI3 Protein (NBP1-93523PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ORAI3 Products

Bioinformatics Tool for ORAI3 Protein (NBP1-93523PEP)

Discover related pathways, diseases and genes to ORAI3 Protein (NBP1-93523PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ORAI3 Protein (NBP1-93523PEP)

Discover more about diseases related to ORAI3 Protein (NBP1-93523PEP).
 

Pathways for ORAI3 Protein (NBP1-93523PEP)

View related products by pathway.

PTMs for ORAI3 Protein (NBP1-93523PEP)

Learn more about PTMs related to ORAI3 Protein (NBP1-93523PEP).

Blogs on ORAI3

There are no specific blogs for ORAI3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

STIM1 Antibody (5A2)
H00006786-M01
STIM1 Antibody (5A2)
H00006786-M01
STIM1 Antibody (5A2)
H00006786-M01
ORAI3 Antibody
NBP1-93523
ORAI3 Antibody
NBP1-93523
ORAI3 Antibody
NBP1-93523
TRPM2 Antibody
NB110-81601
TRPM2 Antibody
NB110-81601
TRPM2 Antibody
NB110-81601

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ORAI3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ORAI3