OR2H2 Antibody

Western Blot: OR2H2 Antibody [NBP3-09987] - Western blot analysis of OR2H2 in Mouse Liver lysates. Antibody dilution at 1.0ug/ml

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

OR2H2 Antibody Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of mouse OLFR90 (NP_009091.3). Peptide sequence LQPKNPYAQERGKFFGLFYAVGTPSLNPLIYTLRNKEVTRAFRRLLGKEM
• Clonality: Polyclonal
• Host: Rabbit
• Gene: OR2H2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 35 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS buffer, 2% sucrose.
• Preservative: 0.09% Sodium Azide
• Purity: Affinity purified

Alternate Names for OR2H2 Antibody

• FAT11
• hs6M1-12
• MGC126732
• MGC138381
• Olfactory receptor 2
• olfactory receptor 2H2
• Olfactory receptor 2H3
• olfactory receptor OR6-36
• olfactory receptor, family 2, subfamily H, member 2
• olfactory receptor, family 2, subfamily H, member 3
• Olfactory receptor-like protein FAT11
• OLFR2OLFR42B
• OR2H3dJ271M21.2

Background

OR2H2, also known as Olfactory receptor 2H2, is a 34.7 kDa, 312 amino acid protein that is involved in recognition and transduction of odorant signals as a member of the olfactory receptor gene family. Diseases such as lupus erythematosus, multiple sclerosis, systemic lupus erythematosus, and neuronitis are currently being researched with the protein. The protein interacts in signal transduction, GPCR downstream signaling, and olfactory signaling pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: OR2H2