ONECUT2/OC-2 Antibody - BSA Free

Western Blot: ONECUT2/OC-2 Antibody [NBP2-87986] - WB Suggested Anti-ONECUT2 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: NCI-H226 cell lysateONECUT2 is supported by BioGPS gene expression data to be expressed in NCIH226

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ONECUT2/OC-2 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ONECUT2/OC-2. Peptide sequence: LQEPEFQRMSALRLAACKRKEQEPNKDRNNSQKKSRLVFTDLQRRTLFAI The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ONECUT2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ONECUT2/OC-2 Antibody - BSA Free

• one cut domain family member 2
• HNF-6B
• OC2
• OC-2
• one cut homeobox 2
• ONECUT2

Background

The ONECUT2 gene encodes a member of the onecut family of transcription factors, which are characterized by a cut domain and an atypical homeodomain. The protein binds to specific DNA sequences and stimulates expression of target genes, including genes involved

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ONECUT2