OFD1 Antibody - BSA Free

Immunohistochemistry-Paraffin: OFD1 Antibody [NBP1-89355] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: OFD1 Antibody [NBP1-89355] - Staining of human testis shows strong cytoplasmic positivity in seminiferous ducts.

Immunohistochemistry-Paraffin: OFD1 Antibody [NBP1-89355] - Staining of human prostate shows strong cytoplasmic positivity in smooth muscle cells.

Immunohistochemistry-Paraffin: OFD1 Antibody [NBP1-89355] - Staining of human stomach shows moderate cytoplasmic positivity in glandular cells.

Product Discontinued

OFD1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit OFD1 Antibody - BSA Free (NBP1-89355) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-OFD1 Antibody: Cited in 8 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LLKEEKLELLAQNKLLKQQLEESRNENLRLLNRLAQPAPELAVFQKELRKAEKAIVVEHEEFESCRQALHKQLQDEIEHSAQLKAQILGYKA
• Localization: Cytoskeleton (microtubules)
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: OFD1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence Reported in scientific literature (PMID:34078910)
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot Reported in scientific literature (PMID: 25180832)
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  OFD1 Protein (NBP1-89355PEP)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 25180832).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for OFD1 Antibody - BSA Free

• JBTS10
• MGC117039
• oral-facial-digital syndrome 1
• SGBS2

Background

The OFD1 gene is located on the X chromosome and encodes a centrosomal protein. A knockout mouse model has been used to study the effect of mutations in this gene. The mouse gene is also located on the X chromosome, however, unlike the human gene it is not su

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for OFD1 Antibody (NBP1-89355)(9)

Publications using NBP1-89355

• Chao Y, Huang B, Peng I et al. ATM- and ATR-Induced Primary Ciliogenesis Promotes Cisplatin Resistance in Pancreatic Ductal Adenocarcinoma Research Square 2021-12-02 [PMID: 36251015]
• Yamamoto Y, Chino H, Tsukamoto S et al. NEK9 regulates primary cilia formation by acting as a selective autophagy adaptor for MYH9/myosin IIA Nature communications 2021-06-02 [PMID: 34078910] (IF/IHC, WB, ICC/IF, Mouse, Human)
• Wang WJ, Tay HG, Soni R et al. CEP162 is an axoneme-recognition protein promoting ciliary transition zone assembly at the cilia base. Nat Cell Biol 2013-06-01 [PMID: 23644468]
• Pajkos M, Szaniszló T, Fülöp M, Dosztányi Z Entering new circles: Expansion of the LC8/DYNLL1 interactome in the ciliary-centrosomal network through system-driven motif evolution bioRxiv 2023-09-17 (ICC/IF, Human)
• Chen TY, Huang BM, Tang TK, et al. Genotoxic stress-activated DNA-PK-p53 cascade and autophagy cooperatively induce ciliogenesis to maintain the DNA damage response Cell death and differentiation 2021-01-18 [PMID: 33462409]
• Chen TY, Lin TC, Kuo PL et al. Septin 7 is a centrosomal protein that ensures S phase entry and microtubule nucleation by maintaining the abundance of p150glued J. Cell. Physiol. 2020-09-01 [PMID: 32869310]
• Zhang C, Li C et al. Distinct Roles of TRAPPC8 and TRAPPC12 in Ciliogenesis via Their Interactions With OFD1. Front Cell Dev Biol 2020-08-04 [PMID: 32258032] (ICC/IF, Human)
• Takahashi K, Nagai T, Chiba S et al. Glucose deprivation induces primary cilium formation through mTORC1 inactivation J. Cell. Sci. 2017-11-27 [PMID: 29180513] (Human)
• Jerman S, Ward HH, Lee R et al. OFD1 and Flotillins Are Integral Components of a Ciliary Signaling Protein Complex Organized by Polycystins in Renal Epithelia and Odontoblasts. PLoS ONE. 2014-09-03 [PMID: 25180832] (WB, Mouse)

Bioinformatics

• Gene Symbol: OFD1
• Entrez:
  • 8481(Human)
• Uniprot:
  • O75665(Human)