OFD1 Antibody

Images

 
Immunohistochemistry-Paraffin: OFD1 Antibody [NBP1-89355] - Staining of human stomach shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

OFD1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LLKEEKLELLAQNKLLKQQLEESRNENLRLLNRLAQPAPELAVFQKELRKAEKAIVVEHEEFESCRQALHKQLQDEIEHSAQLKAQILGYKA
Localization
Cytoskeleton (microtubules)
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OFD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. \
Control Peptide
OFD1 Protein (NBP1-89355PEP)
Publications
Read Publications using
NBP1-89355 in the following applications:

  • WB
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23644468)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for OFD1 Antibody

  • JBTS10
  • MGC117039
  • oral-facial-digital syndrome 1
  • SGBS2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13288
Species: Hu
Applications: WB, IHC, IHC-P
NB100-86991
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NBP1-86759
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-87769
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00027130-P02
Species: Hu
NBP1-87196
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB5175
Species: Mu
Applications: WB, IHC
NBP1-92123
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2475
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-42632
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-86248
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-46837
Species: Hu, Mu
Applications: WB, IP
NBP2-15309
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00004867-D01P
Species: Hu, Mu
Applications: WB
NBP2-32157
Species: Hu
Applications: WB, IHC-P, IP
NBP1-84403
Species: Hu
Applications: IHC, IHC-P
NBP1-83826
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56537
Species: Hu, Mu
Applications: WB, ChIP, IP
NBP1-89355
Species: Hu
Applications: IHC, IHC-P

Publications for OFD1 Antibody (NBP1-89355)(2)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for OFD1 Antibody (NBP1-89355) (0)

There are no reviews for OFD1 Antibody (NBP1-89355). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for OFD1 Antibody (NBP1-89355) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional OFD1 Products

OFD1 NBP1-89355

Bioinformatics Tool for OFD1 Antibody (NBP1-89355)

Discover related pathways, diseases and genes to OFD1 Antibody (NBP1-89355). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OFD1 Antibody (NBP1-89355)

Discover more about diseases related to OFD1 Antibody (NBP1-89355).
 

Pathways for OFD1 Antibody (NBP1-89355)

View related products by pathway.

PTMs for OFD1 Antibody (NBP1-89355)

Learn more about PTMs related to OFD1 Antibody (NBP1-89355).

Blogs on OFD1

There are no specific blogs for OFD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OFD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OFD1
Entrez
Uniprot