ODF2 Recombinant Protein Antigen

Images

 
There are currently no images for ODF2 Protein (NBP1-85417PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ODF2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ODF2.

Source: E. coli

Amino Acid Sequence: HKRGMKGDTVNVRRSVRVKTKNPPHCLEITPPSSEKLVSVMRLSDLSTEDDDSGHCKMNRYDKKIDSLMNAVGCLKSEVKMQKGERQMAKRFLEERKEELEEVAHELAETEHENTVLRHNIERMKEEKDFTILQKKHLQQEKE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ODF2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85417.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ODF2 Recombinant Protein Antigen

  • Cenexin
  • FLJ44866
  • MGC111096
  • MGC9034
  • ODF2/1
  • ODF2/2
  • ODF8484-kD
  • outer dense fiber of sperm tails 2
  • outer dense fiber protein 2
  • sperm tail structural protein

Background

Cenexin-1, also known as ODF2 and outer dense fiber of sperm tails 2, are cytoskeletal structures that surround the axoneme in the middle piece and principal piece of the sperm tail. The fibers function in maintaining the elastic structure and recoil of the sperm tail as well as in protecting the tail from shear forces during epididymal transport and ejaculation. Defects in the outer dense fibers lead to abnormal sperm morphology and infertility. Cenexin-1 is one of the major outer dense fiber proteins. Multiple protein isoforms are encoded by transcript variants of the cenexin gene; however, not all isoforms and variants have been fully described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-47266
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP3-45857
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
462-TEC
Species: Mu
Applications: BA
NB100-74638
Species: Hu
Applications: ICC/IF, IP, WB (-)
NBP3-32652
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-74502
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-88795
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-37602
Species: Hu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-12242
Species: Ch, Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-90614
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-31979
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
AF2030
Species: Hu
Applications: IHC, WB
NB100-2305
Species: Hu, Rt
Applications: ICC/IF, IHC, IP, WB
NBP2-14040
Species: Hu
Applications: IHC,  IHC-P, WB
NBP3-17139
Species: Hu
Applications: IHC,  IHC-P
NBP1-90363
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-58906
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-85417PEP
Species: Hu
Applications: AC

Publications for ODF2 Protein (NBP1-85417PEP) (0)

There are no publications for ODF2 Protein (NBP1-85417PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ODF2 Protein (NBP1-85417PEP) (0)

There are no reviews for ODF2 Protein (NBP1-85417PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ODF2 Protein (NBP1-85417PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ODF2 Products

Array NBP1-85417PEP

Research Areas for ODF2 Protein (NBP1-85417PEP)

Find related products by research area.

Blogs on ODF2

There are no specific blogs for ODF2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ODF2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ODF2