OCTN1/SLC22A4 Antibody (2D3)

Images

 
Western Blot: OCTN1/SLC22A4 Antibody (2D3) [H00006583-M01] - SlC22A expression in rat kidney. Image form verified customer review.
Western Blot: OCTN1/SLC22A4 Antibody (2D3) [H00006583-M01] - Detection of SLC22A4 in mouse liver. Image from verified customer review.
ELISA: OCTN1/SLC22A4 Antibody (2D3) [H00006583-M01] - Detection limit for recombinant GST tagged SLC22A4 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications ELISA
Clone
2D3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

OCTN1/SLC22A4 Antibody (2D3) Summary

Immunogen
SLC22A4 (NP_003050, 43 a.a. - 141 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AGTPEHRCRVPDAANLSSAWRNNSVPLRLRDGREVPHSCSRYRLATIANFSALGLEPGRDVDLGQLEQESCLDGWEFSQDVYLSTVVTEWNLVCEDNWK
Specificity
SLC22A4 - solute carrier family 22 (organic cation transporter), member 4 (2D3)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SLC22A4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
WB usage reported from customer review.
Reviewed Applications
Read 1 Review rated 4
using
H00006583-M01 in the following application:

Reactivity Notes

Rat reactivity reported from customer review.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for OCTN1/SLC22A4 Antibody (2D3)

  • Ergothioneine transporter
  • ET transporter
  • ETT
  • MGC34546
  • MGC40524
  • OCTN1
  • OCTN1integral membrane transport protein
  • Organic cation/carnitine transporter 1
  • SLC22A4
  • solute carrier family 22 (organic cation/ergothioneine transporter), member 4
  • solute carrier family 22 member 4
  • UT2H

Background

Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. The encoded protein is an organic cation transporter and plasma integral membrane protein containing eleven putative transmembrane domains as well as a nucleotide-binding site motif. Transport by this protein is at least partially ATP-dependent. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-57222
Species: Hu
Applications: ICC/IF
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-51684
Species: Hu
Applications: WB, ELISA, Flow
NBP1-89417
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-21584
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-55619
Species: Hu
Applications: ICC/IF
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-264
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
H00005452-D01P
Species: Hu, Mu, Rt
Applications: WB
NB600-1147
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, IHC-P, Flow-CS
AF2485
Species: Hu
Applications: WB, IHC, IP
AF7895
Species: Hu
Applications: WB, IHC
NBP2-46466
Species: Hu
Applications: IHC
NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2009
Species: Hu
Applications: WB, IHC
NB110-60928
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, EM, IHC, IHC-P

Publications for OCTN1/SLC22A4 Antibody (H00006583-M01) (0)

There are no publications for OCTN1/SLC22A4 Antibody (H00006583-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for OCTN1/SLC22A4 Antibody (H00006583-M01) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Rat.
We have 1 review tested in 1 application: WB.

Reviews using H00006583-M01:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Rat
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot OCTN1/SLC22A4 H00006583-M01
Enlarge
reviewed by:
Adam David
WB Rat 07/09/2014
View

Summary

ApplicationWestern Blot
Sample TestedRAT KIDNEY
SpeciesRat

Blocking

Blocking Details5% Milk, 1h, room temperature

Primary Anitbody

Dilution Ratio1:200

Secondary Antibody

Secondary DescriptionGoat anti-mouse HRP
Secondary Concentration1:5000

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for OCTN1/SLC22A4 Antibody (H00006583-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional OCTN1/SLC22A4 Products

Bioinformatics Tool for OCTN1/SLC22A4 Antibody (H00006583-M01)

Discover related pathways, diseases and genes to OCTN1/SLC22A4 Antibody (H00006583-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OCTN1/SLC22A4 Antibody (H00006583-M01)

Discover more about diseases related to OCTN1/SLC22A4 Antibody (H00006583-M01).
 

Pathways for OCTN1/SLC22A4 Antibody (H00006583-M01)

View related products by pathway.

PTMs for OCTN1/SLC22A4 Antibody (H00006583-M01)

Learn more about PTMs related to OCTN1/SLC22A4 Antibody (H00006583-M01).

Blogs on OCTN1/SLC22A4

There are no specific blogs for OCTN1/SLC22A4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Adam David
07/09/2014
Application: WB
Species: Rat

Bioinformatics

Gene Symbol SLC22A4
Entrez
Uniprot