NXF5 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human NXF5. Peptide sequence: FTPVDFHYIRNRACFFVQVASAASALKDVSYKIYDDENQKICIFVSHFTA The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
NXF5 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for NXF5 Antibody - BSA Free
Background
NXF5, also known as Nuclear RNA export factor 5, consists of 6 isoforms ranging from a 168 amino acid isoform that is 20 kDa to a 397 amino acid isoform that is 46 kDa, it is implicated in mRNA nuclear export and could also have a role in polarized cytoplasmic transport and localization of mRNA in neurons. On the other hand, this protein has lost several C-terminal protein domains found in other family members that are required for export activity, and may be an evolving pseudogene. Current research is being performed on several diseases including pelizaeus-merzbacher disease, premature ovarian failure, short stature, intellectual disability, influenza, and neuronitis. The NXF5 has shown an interaction with ALYREF, EIF4A3, NUP98, NUPL2, NXT1, NXT2, RAE1, and THOC5 in ribosome biogenesis in eukaryotes, RNA transport, mRNA surveillance pathway, and influenza A pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt, Sh
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
Species: Mu
Applications: IHC, Simple Western, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, KD, S-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Publications for NXF5 Antibody (NBP2-84196) (0)
There are no publications for NXF5 Antibody (NBP2-84196).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for NXF5 Antibody (NBP2-84196) (0)
There are no reviews for NXF5 Antibody (NBP2-84196).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for NXF5 Antibody (NBP2-84196) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional NXF5 Products
Blogs on NXF5