NXF5 Antibody - BSA Free

Western Blot: NXF5 Antibody [NBP2-84196] - WB Suggested Anti-NXF5 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: COLO205 cell lysate

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

NXF5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NXF5 Antibody - BSA Free (NBP2-84196) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human NXF5. Peptide sequence: FTPVDFHYIRNRACFFVQVASAASALKDVSYKIYDDENQKICIFVSHFTA The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NXF5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for NXF5 Antibody - BSA Free

• nuclear RNA export factor 5
• TAPL1
• TAPL-1
• TAP-like protein 1

Background

NXF5, also known as Nuclear RNA export factor 5, consists of 6 isoforms ranging from a 168 amino acid isoform that is 20 kDa to a 397 amino acid isoform that is 46 kDa, it is implicated in mRNA nuclear export and could also have a role in polarized cytoplasmic transport and localization of mRNA in neurons. On the other hand, this protein has lost several C-terminal protein domains found in other family members that are required for export activity, and may be an evolving pseudogene. Current research is being performed on several diseases including pelizaeus-merzbacher disease, premature ovarian failure, short stature, intellectual disability, influenza, and neuronitis. The NXF5 has shown an interaction with ALYREF, EIF4A3, NUP98, NUPL2, NXT1, NXT2, RAE1, and THOC5 in ribosome biogenesis in eukaryotes, RNA transport, mRNA surveillance pathway, and influenza A pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NXF5