We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human NUT GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Product Discontinued
View other related NUT Peptides and Proteins

Order Details


    • Catalog Number
      H00256646-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human NUT GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1033-1132 of Human NUT

Source: Wheat Germ (in vitro)

Amino Acid Sequence: REHPLSPHHASGGQGSQRASHLLPAGAKGPSKLPYPVAKSGKRALAGGPAPTEKTPHSGAQLGVPREKPLALGVVRPSQPRKRRCDSFVTGRRKKRRRSQ

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
NUTM1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NUT GST (N-Term) Protein

  • C15orf55
  • chromosome 15 open reading frame 55
  • DKFZp434O192
  • FAM22H
  • MGC138683
  • MGC138684
  • Nuclear protein in testis
  • NUT
  • protein NUT

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-76393
Species: Hu, Mu
Applications: CHIP-SEQ, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-14360
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
AF7355
Species: Hu
Applications: ICC, Simple Western, WB
NB100-56576
Species: V, V, V-Vi
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr,  IHC-P, PAGE, WB
AF1916
Species: Hu
Applications: ICC, IHC, WB
NBP1-18885
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, KO, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-16602
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP1-89544
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NB100-616
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, KD, WB
NB100-56530
Species: Hu
Applications: WB
NB100-355
Species: Bv, Ca, Ch, Hu, Mu, Po, Pm, Rt, Xp
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-Fr,  IHC-P, IP, In vivo, KO, Simple Western, WB
NB600-1071
Species: Hu(-), Mu
Applications: COMET, ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, mIF, WB
NBP2-45545
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB500-487
Species: Bv, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
H00256646-Q01
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for NUT Partial Recombinant Protein (H00256646-Q01) (0)

There are no publications for NUT Partial Recombinant Protein (H00256646-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NUT Partial Recombinant Protein (H00256646-Q01) (0)

There are no reviews for NUT Partial Recombinant Protein (H00256646-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NUT Partial Recombinant Protein (H00256646-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NUT Products

Array H00256646-Q01

Research Areas for NUT Partial Recombinant Protein (H00256646-Q01)

Find related products by research area.

Blogs on NUT.

Understanding the relationship between NUT and BET proteins in NMC
NUT has been found to fuse with bromodomain-containing proteins 3 and 4 (BRD3 and BRD4) in NUT midline carcinoma (NMC), a very rare, extremely aggressive, and genetically defined human cancer. NMC has recently been designated as a sub classificati...  Read full blog post.

NUT - A Protein Coding Gene
The NUT gene is found on chromosome 15q14 and encodes for the NUT protein which is a key component of the RNA polymerase II Mediator complex. This multi-subunit assembly is required for all RNA pol II-dependent transcriptional activation, coordinating...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NUT GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NUTM1