NULP1 Antibody

Western Blot: NULP1 Antibody [NBP1-92211] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Immunohistochemistry-Paraffin: NULP1 Antibody [NBP1-92211] - Staining of human liver.

Western Blot: NULP1 Antibody [NBP1-92211] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunohistochemistry-Paraffin: NULP1 Antibody [NBP1-92211] - Staining of human uterus, pre-menopause, shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: NULP1 Antibody [NBP1-92211] - Staining of human adrenal gland, colon, kidney and liver using Anti-TCF25 antibody NBP1-92211 (A) shows similar protein distribution across tissues to independent antibody NBP1-92210 (B).

Immunohistochemistry-Paraffin: NULP1 Antibody [NBP1-92211] - Staining of human adrenal gland.

Immunohistochemistry-Paraffin: NULP1 Antibody [NBP1-92211] - Staining of human kidney.

Immunohistochemistry-Paraffin: NULP1 Antibody [NBP1-92211] - Staining of human colon.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

NULP1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QEWEAHRNLSQLPNFAFSVPLAYFLLSQQTDLPECEQSSARQKASLLIQQALTMFPGVLLPLLESCSVRPDASVSSHRFFGPNAEISQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TCF25
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  NULP1 Protein (NBP1-92211PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NULP1 Antibody

• hKIAA1049
• KIAA1049Hulp1
• Nuclear localized protein 1
• Nulp1
• NULP1PRO2620
• TCF-25
• transcription factor 25 (basic helix-loop-helix)
• transcription factor 25

Background

TCF25 is a member of the basic helix-loop-helix (bHLH) family of transcription factors that are important in embryonic development (Steen and Lindholm, 2008 [PubMed 18068114]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TCF25