NT5DC3 Antibody

Images

 
Western Blot: NT5DC3 Antibody [NBP3-09628] - Western blot analysis of NT5DC3 in Jurkat Whole Cell lysates. Antibody dilution at 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NT5DC3 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human NT5DC3 (NP_001026871). Peptide sequence GLLEQMQVHRDAESQLVLQEWKKERKEMREMTKSFFNAQFGSLFRTDQNP
Clonality
Polyclonal
Host
Rabbit
Gene
NT5DC3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
60 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS buffer, 2% sucrose.
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for NT5DC3 Antibody

  • 5'-nucleotidase domain containing 3
  • FLJ11266

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-58076
Species: Hu
Applications: ICC/IF
AF6240
Species: Hu
Applications: WB, ELISA, IHC
NBP1-85740
Species: Hu, Po
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-86165
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-619
Species: Hu, Mu, Rt, Bv, Ch, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP, ICC
AF7879
Species: Hu, Mu, Rt
Applications: WB, IHC, ICC
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-501
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, Gp, Ha, Le, Ma, Pm, Rb, Sh, Sq, Tr, Ze, Dr(-)
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ChIP, KD, KO
NBP2-93413
Species: Hu, Mu
Applications: WB
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, MiAr
H00005729-B01P
Species: Hu
Applications: WB, Flow, ICC/IF
NBP3-09628
Species: Hu
Applications: WB

Publications for NT5DC3 Antibody (NBP3-09628) (0)

There are no publications for NT5DC3 Antibody (NBP3-09628).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NT5DC3 Antibody (NBP3-09628) (0)

There are no reviews for NT5DC3 Antibody (NBP3-09628). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NT5DC3 Antibody (NBP3-09628) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NT5DC3 Products

Array NBP3-09628

Bioinformatics Tool for NT5DC3 Antibody (NBP3-09628)

Discover related pathways, diseases and genes to NT5DC3 Antibody (NBP3-09628). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NT5DC3 Antibody (NBP3-09628)

Discover more about diseases related to NT5DC3 Antibody (NBP3-09628).

Blogs on NT5DC3

There are no specific blogs for NT5DC3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NT5DC3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NT5DC3