Home » NT5C3 » NT5C3 Antibodies » NT5C3 Antibody

NT5C3 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: NT5C3 Antibody [NBP2-87949] - WB Suggested Anti-NT5C3 Antibody Titration: 0.2-1 ug/ml. Positive Control: HepG2 cell lysate
Western Blot: NT5C3 Antibody [NBP2-87949] - WB Suggested Anti-NT5C3 Antibody Titration: 0.2-1 ug/ml. Positive Control: HepG2 cell lysate

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

NT5C3 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human NT5C3. Peptide sequence: VKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNII The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
NT5C3A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NT5C3 Antibody

  • 5'-nucleotidase, cytosolic III
  • cN-IIIMGC87828
  • cytosolic 5'-nucleotidase 3
  • Cytosolic 5'-nucleotidase III
  • p36
  • P5N1
  • P5N-1
  • P5'N-1MGC27337
  • PN-IMGC87109
  • PSN1UMPH
  • Pyrimidine 5'-nucleotidase 1
  • UMPH1EC 3.1.3.5
  • uridine 5' monophosphate hydrolase 1
  • Uridine 5'-monophosphate hydrolase 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Annexin A2
Antibody (1G7)
H00000302-M02
Immunocytochemistry/Immunofluorescence: Annexin A2 Antibody (1G7) [H00000302-M02] - Localization of annexin A2 at the focal adhesions: KS1767 cells co-stained for paxillin (FITC-conjugated secondary antibody, green) and annexin A2 (Alexa 647-conjugated secondary antibody, red). An enlarged inset (white dotted line) is included for prompt visualization. Nuclei are visualized with DAPI (blue); scale bar, 10um. Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41598-017-03470-w), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: Annexin A2 Antibody (1G7) [H00000302-M02] - Co-localization analysis: KS1767 cells grown overnight onto circular coverslips were incubated for 2h at 37degrees C with biotinylated LGRFYAASG-pen, or unconjugated LGRFYAASG (10uM). Untreated cells were used as controls. IF staining of biotinylated peptides (avidin-FITC, green) and annexin A2 (Cy3-conjugated secondary antibody, red) was analyzed with Fiji ImageJ. Co-localized pixels are visualized in white (arrows), and Manders' overlap coefficients are reported in the graph (**P<0.01; ***P<0.001 versus LGRFYAASG-pen). Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41598-017-03470-w), licensed under a CC-BY licence.
Western Blot: Annexin A2 Antibody (1G7) [H00000302-M02] - Analysis of ANXA2 expression in transfected 293T cell line by ANXA2 monoclonal antibody (M02), clone 1G7.Lane 1: ANXA2 transfected lysate(40.4 KDa).Lane 2: Non-transfected lysate.
(1 Review)
(6 Publications)
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IP, WB
S100A10 Antibody
[Unconjugated]
AF2377
Western blot shows lysates of mouse lung and MEF mouse embryonic feeder cells. PVDF membrane was probed with 0.1 µg/mL of Goat Anti-Mouse S100A10 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2377) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for S100A10 at approximately 11 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
S100A10 was detected in perfusion fixed frozen sections of mouse kidney using Goat Anti-Mouse S100A10 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2377) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to plasma membrane in epithelial cells. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Simple Western lane view shows lysates of mouse lung tissue and MEF mouse embryonic feeder cells, loaded at 0.2 mg/mL. A specific band was detected for S100A10 at approximately 11 kDa (as indicated) using 1 µg/mL of Goat Anti-Mouse S100A10 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2377) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
(11 Publications)
Species: Mu
Applications: IHC, Simple Western, WB
P11 Antibody
NBP1-82458
Immunohistochemistry-Paraffin: P11 Antibody [NBP1-82458] - Staining of human endometrium shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: P11 Antibody [NBP1-82458] - Staining of human esophagus shows strong cytoplasmic positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: P11 Antibody [NBP1-82458] - Staining of human esophagus, placenta, skeletal muscle and skin using Anti-ENDOU antibody NBP1-82458 (A) shows similar protein distribution across tissues to independent antibody NBP2-55877 (B).
Species: Hu
Applications: IHC, IHC-P
Exosome component
6 Antibody
NBP1-57508
Western Blot: Exosome component 6 Antibody [NBP1-57508] - Jurkat cell lysate, Antibody Titration: 5.0ug/ml
Immunohistochemistry-Paraffin: Exosome component 6 Antibody [NBP1-57508] - Human Liver Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Hepatocytes (indicated with arrows) 400X magnification.
Immunohistochemistry-Paraffin: Exosome component 6 Antibody [NBP1-57508] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.
Species: Hu
Applications: IHC, IHC-P, WB
ERK2 Antibody
(SZ25-01)
NBP2-67360
Flow Cytometry: ERK2 Antibody (SZ25-01) [NBP2-67360] - Analysis of Hela cells with ERK2 antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunocytochemistry/Immunofluorescence: ERK2 Antibody (SZ25-01) [NBP2-67360] - Staining ERK2 in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: ERK2 Antibody (SZ25-01) [NBP2-67360] - Staining ERK2 in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
(1 Review)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
CDK5 Activator 1
Antibody
NBP3-13279
Immunocytochemistry/Immunofluorescence: CDK5 Activator 1 Antibody [NBP3-13279] - CDK5 Activator 1 antibody detects CDK5 Activator 1 protein by immunofluorescent analysis. Sample: DIV10 rat E18 primary cortical neuron cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: CDK5 Activator 1 stained by CDK5 Activator 1 antibody (NBP3-13279) diluted at 1:500. Red: alpha Tubulin, stained by alpha Tubulin antibody [GT114] (NBP2-43837) diluted at 1:500. Blue: Fluoroshield with DAPI.
Immunohistochemistry-Paraffin: CDK5 Activator 1 Antibody [NBP3-13279] - CDK5 Activator 1 antibody detects CDK5 Activator 1 protein by immunohistochemical analysis. Sample: Paraffin-embedded mouse brain. CDK5 Activator 1 stained by CDK5 Activator 1 antibody (NBP3-13279) diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min
Immunohistochemistry-Paraffin: CDK5 Activator 1 Antibody [NBP3-13279] - CDK5 Activator 1 antibody detects CDK5 Activator 1 protein by immunohistochemical analysis. Sample: Paraffin-embedded rat brain. CDK5 Activator 1 stained by CDK5 Activator 1 antibody (NBP3-13279) diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Annexin A1
Antibody (2F1)
NBP2-23485
Western Blot: Annexin A1 Antibody (2F1) [NBP2-23485] - WB detection of ANXA1 in human ANXA1 recombinant protein.
Western Blot: Annexin A1 Antibody (2F1) [NBP2-23485] - WB analysis of ANXA1 in (1) Hela, (2) A549, (3) K562, (4) NIH3T3, (5) C6, and (6) COS7 cell lysate.
Immunohistochemistry: Annexin A1 Antibody (2F1) [NBP2-23485] - IHC analysis of paraffin embedded human cervical cancer tissues with DAB staining.
(1 Review)
(2 Publications)
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Cyclin H Antibody
(SN20-48)
NBP2-67719
Flow Cytometry: Cyclin H Antibody (SN20-48) [NBP2-67719] - Analysis of Hela cells with Cyclin H antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunocytochemistry/Immunofluorescence: Cyclin H Antibody (SN20-48) [NBP2-67719] - Staining Cyclin H in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: Cyclin H Antibody (SN20-48) [NBP2-67719] - Staining Cyclin H in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
HABP1/C1QBP/GC1q R
Antibody
NBP1-89790
Western Blot: HABP1/C1QBP/GC1q R Antibody [NBP1-89790] - Analysis in human cell lines HEK293 and U2OS using Anti-C1QBP antibody. Corresponding C1QBP RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Immunohistochemistry-Paraffin: HABP1/C1QBP/GC1q R Antibody [NBP1-89790] - Staining of human colon shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: HABP1/C1QBP/GC1q R Antibody [NBP1-89790] - Staining of human lymph node shows strong granular cytoplasmic positivity in non-germinal and germinal center cells.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Calcium-binding-protei
NBP1-33736
Immunohistochemistry-Paraffin: Calcium-binding-protein-P22 Antibody [NBP1-33736] - Paraffin-embedded mouse lung. Calcium binding protein P22 antibody dilution: 1:500.
Immunocytochemistry/Immunofluorescence: Calcium-binding-protein-P22 Antibody [NBP1-33736] - HepG2 cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Calcium binding protein P22 protein stained by Calcium binding protein P22 antibody diluted at 1:500. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: Calcium-binding-protein-P22 Antibody [NBP1-33736] - Paraffin-embedded SW480 xenograft, using antibody at 1:100 dilution.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Prostatic Acid
Phosphatase/ACPP Anti ...
AF6240
Western blot shows lysates of LNCaP human prostate cancer cell line. PVDF Membrane was probed with 1 µg/mL of Human Prostatic Acid Phosphatase/ACPP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6240) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Prostatic Acid Phosphatase/ACPP at approximately 50-55 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Prostatic Acid Phosphatase/ACPP was detected in immersion fixed paraffin-embedded sections of human prostate using Human Prostatic Acid Phosphatase/ACPP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6240) at 3 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hemotoxylin (blue). Specific staining was localized to the cytoplasm of epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Recombinant Human Prostatic Acid Phosphatase/ACPP protein was serially diluted 2-fold and captured by Mouse Anti-Human Prostatic Acid Phosphatase/ACPP Monoclonal Antibody (Catalog # MAB62401) coated on a Clear Polystyrene Microplate (Catalog # DY990). Sheep Anti-Human Prostatic Acid Phosphatase/ACPP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6240) was biotinylated and incubated with the protein captured on the plate. Detection of the standard curve was achieved by incubating Streptavidin-HRP (Catalog # DY998) followed by Substrate Solution (Catalog # DY999) and stopping the enzymatic reaction with Stop Solution (Catalog # DY994).
(1 Publication)
Species: Hu
Applications: ELISA, IHC, WB

5'-Nucleotidase/CD73 A ...
NBP2-48480
Flow (Cell Surface): 5'-Nucleotidase/CD73 Antibody (AD2) [NBP2-48480] - A surface stain was performed on U87 MG cells with 5'-Nucleotidase/CD73 Antibody (AD2) antibody NBP2-48480 (blue) and a matched isotype control (orange). Cells were incubated in an antibody dilution of 1 ug/mL for 20 minutes at room temperature, followed by Dylight488-conjugated anti-mouse secondary antibody.
Flow (Cell Surface): 5'-Nucleotidase/CD73 Antibody (AD2) [NBP2-48480] - A cell surface stain was performed on U87MG cells with NBP2-48480APC (blue) and a matched isotype control NBP2-27287APC (orange). Cells were incubated in an antibody dilution of 0.5 ug/mL for 20 minutes at room temperature. Both antibodies were conjugated to Allophycocyanin. Image using the Allophycocyanin form of this antibody.
Flow Cytometry: 5'-Nucleotidase/CD73 Antibody (AD2) [NBP2-48480] - A surface stain was performed on CD3+ human peripheral blood lymphocytes with CD73 (AD2) antibody NBP2-48480AF488 and a matched isotype control NBP2-27287AF488. Cells were incubated in an antibody dilution of 10 ug/mL for 20 minutes at room temperature. A co-stain was performed with NBP2-25186PCP.
(1 Review)
(15 Publications)
Species: Hu
Applications: Flow-CS, Flow, IHC, IHC-Fr, IHC-P
GRAP2 Antibody
(OTI1G2)
NBP2-00764
Flow Cytometry: GRAP2 Antibody (1G2) [NBP2-00764] - Analysis of Jurkat cells, using anti-GRAP2 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: GRAP2 Antibody (1G2) [NBP2-00764] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-GRAP2 antibody, and then analyzed by flow cytometry.
Western Blot: GRAP2 Antibody (1G2) [NBP2-00764] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY GRAP2 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-GRAP2.
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
CDCA5 Antibody
NBP1-89530
Western Blot: CDCA5 Antibody [NBP1-89530] - Analysis in human cell line SCLC-21H.
Immunohistochemistry-Paraffin: CDCA5 Antibody [NBP1-89530] - Staining of human bone marrow shows immune cell positivity in hematopoietic cells.
Immunocytochemistry/Immunofluorescence: CDCA5 Antibody [NBP1-89530] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Ficolin-2 Antibody
AF2428
Ficolin-2 Antibody
Species: Hu
Applications: WB
Uroplakin IIIB
Antibody
NBP1-92564
Immunohistochemistry-Paraffin: Uroplakin IIIB Antibody [NBP1-92564] - Staining of human urninary bladder shws strong postivity in apical membrane in urothelial cells.
Immunohistochemistry-Paraffin: Uroplakin IIIB Antibody [NBP1-92564] - Staining of human lung shows moderate membranous and cytoplasmic psotivity in macrophages.
Immunohistochemistry-Paraffin: Uroplakin IIIB Antibody [NBP1-92564] - Staining of human placenta shows no positivity in trophoblastic cells as expected.
(1 Review)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
GCHFR Antibody
NBP1-91931
Western Blot: GCHFR Antibody [NBP1-91931] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue
Western Blot: GCHFR Antibody [NBP1-91931] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/Immunofluorescence: GCHFR Antibody [NBP1-91931] - Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoplasm.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
IL-12
[Unconjugated]
419-ML/CF
1 μg/lane of Recombinant Mouse IL-12 was resolved with SDS-PAGE under reducing (R) and non-reducing (NR) conditions and visualized by silver staining, showing single bands at 25 kDa and 43 kDa (R) and 68 kDa (NR) .
Recombinant Mouse IL-12 (Catalog # 419‑ML/CF) stimulates cell proliferation of PHA-activated mouse splenocytes. The ED50 for this effect is 0.01-0.1 ng/mL.
(238 Publications)
Species: Mu
Applications: BA
POLDIP2 Antibody
NBP1-68874
Western Blot: POLDIP2 Antibody [NBP1-68874] - Staining of K562 (A), MCF7 (B) and Mouse Liver (C) lysates (35ug protein in RIPA buffer). Primary incubation was overnight at 4C. Detected by chemiluminescence.
Western Blot: POLDIP2 Antibody [NBP1-68874] - (1ug/ml) Analysis of MCF7 lysate (35ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
(1 Publication)
Species: Hu, Mu, Rt
Applications: PEP-ELISA, WB
Crk Antibody
(3G11E8)
NBP2-37568
ELISA: Crk Antibody (3G11E8) [NBP2-37568] - Red: Control Antigen (100ng); Purple: Antigen (10ng); Green: Antigen (50ng); Blue: Antigen (100ng);
Western Blot: Crk Antibody (3G11E8) [NBP2-37568] - Western blot analysis using CRK mAb against human CRK (AA: 1-204) recombinant protein. (Expected MW is 48.4 kDa)
Western Blot: Crk Antibody (3G11E8) [NBP2-37568] - Western blot analysis using CRK mAb against HEK293 (1) and CRK(AA: 1-204)-hIgGFc transfected HEK293 (2) cell lysate.
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB

Publications for NT5C3 Antibody (NBP2-87949) (0)

There are no publications for NT5C3 Antibody (NBP2-87949).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NT5C3 Antibody (NBP2-87949) (0)

There are no reviews for NT5C3 Antibody (NBP2-87949). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NT5C3 Antibody (NBP2-87949) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NT5C3 Products

Bioinformatics Tool for NT5C3 Antibody (NBP2-87949)

Discover related pathways, diseases and genes to NT5C3 Antibody (NBP2-87949). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NT5C3 Antibody (NBP2-87949)

Discover more about diseases related to NT5C3 Antibody (NBP2-87949).
 

Pathways for NT5C3 Antibody (NBP2-87949)

View related products by pathway.

PTMs for NT5C3 Antibody (NBP2-87949)

Learn more about PTMs related to NT5C3 Antibody (NBP2-87949).

Blogs on NT5C3

There are no specific blogs for NT5C3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NT5C3 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol NT5C3A