NSP 5 alpha 3 alpha Recombinant Protein Antigen

Images

 
There are currently no images for NSP 5 alpha 3 alpha Recombinant Protein Antigen (NBP3-17187PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

NSP 5 alpha 3 alpha Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NSP 5 alpha 3 alpha

Source: E. coli

Amino Acid Sequence: MRSAAKPWNPAIRAGGHGPDRVRPLPAASSGMKSSKSSTSLAFESRLSRLKRASSEDTLNKPGSTAASGVVRLKKTATAGAISELTESRLRSGTGAFTTTKRT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SPECC1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17187.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NSP 5 alpha 3 alpha Recombinant Protein Antigen

  • cytospin-B
  • CYTSBcytospin B
  • FLJ36955
  • HCMOGT-1
  • NSP
  • NSP5
  • Nuclear structure protein 5
  • sperm antigen HCMOGT 1
  • Sperm antigen HCMOGT-1
  • sperm antigen with calponin homology and coiled coil domains 1
  • sperm antigen with calponin homology and coiled-coil domains 1cytokinesis and spindle organization B
  • sperm antigen with calponin-like and coiled coil domains 1
  • structure protein NSP5a3a
  • structure protein NSP5a3b
  • structure protein NSP5b3a
  • structure protein NSP5b3b

Background

NSP 5alpha 3alpha is a novel structure protein with potential roles in ribosome biogenesis and rRNA metabolism/processing. NSP5a3a is highly expressed in certain tumor cell lines, and may serve as a good tumor marker. In these cancer lines, NSP5a3a has been shown to interact with the nucleolar apoptosis protein B23 and may be involved in a novel p73 dependent apoptosis mechanism. Therefore, NSP5a3a is expected to become an important potential target for future cancer treatment research.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82523
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-46642
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
MAB4077
Species: Hu
Applications: IHC, WB
NBP1-82525
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-13306
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-85010
Species: Hu
Applications: IHC,  IHC-P
NBP1-97677
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB110-61646
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
H00002316-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, PLA, WB
NBP3-15868
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
H00003845-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
AF1638
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
NBP2-67344
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
MAB8630
Species: Hu
Applications: IHC, WB
NBP2-02450
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-83239
Species: Bv, Hu
Applications: IHC,  IHC-P, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP2-33498
Species: Hu
Applications: IHC,  IHC-P
NBP2-00532
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB

Publications for NSP 5 alpha 3 alpha Recombinant Protein Antigen (NBP3-17187PEP) (0)

There are no publications for NSP 5 alpha 3 alpha Recombinant Protein Antigen (NBP3-17187PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NSP 5 alpha 3 alpha Recombinant Protein Antigen (NBP3-17187PEP) (0)

There are no reviews for NSP 5 alpha 3 alpha Recombinant Protein Antigen (NBP3-17187PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NSP 5 alpha 3 alpha Recombinant Protein Antigen (NBP3-17187PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NSP 5 alpha 3 alpha Products

Research Areas for NSP 5 alpha 3 alpha Recombinant Protein Antigen (NBP3-17187PEP)

Find related products by research area.

Blogs on NSP 5 alpha 3 alpha

There are no specific blogs for NSP 5 alpha 3 alpha, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NSP 5 alpha 3 alpha Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SPECC1