NSD3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: NSD3 Antibody [NBP1-89851] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli and mitochondria.
Immunohistochemistry-Paraffin: NSD3 Antibody [NBP1-89851] - Staining of human duodenum shows strong coarse granular cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NSD3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NTQPEQTNAGEVASSLSSTEIRRHSQRRHTSAEEEEPPPVKIAWKTAAARKSLPASITMHKGSLDLQKCNMSPVVKIEQVFALQNATGDGKFIDQFVYSTKGIGNKTEISVRGQDRLIISTPNQRNEKPTQSVSSPEATS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WHSC1L1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NSD3 Protein (NBP1-89851PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NSD3 Antibody

  • EC 2.1.1.43
  • FLJ20353
  • histone-lysine N-methyltransferase NSD3
  • MGC126766
  • MGC142029
  • NSD3DKFZp667H044
  • Nuclear SET domain-containing protein 3
  • pp14328
  • Protein whistle
  • WHSC1-like 1 isoform 9 with methyltransferase activity to lysine
  • WHSC1-like protein 1
  • Wolf-Hirschhorn syndrome candidate 1-like 1
  • Wolf-Hirschhorn syndrome candidate 1-like protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52963
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1744
Species: Hu
Applications: IHC-P
H00029107-M08
Species: Hu
Applications: WB, ELISA, ICC/IF
MAB6798
Species: Hu
Applications: WB, ICC
NB100-93325
Species: Hu
Applications: WB, IP
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82805
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52415
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
PP-A8620A-00
Species: Hu, Mu
Applications: WB, IHC, IP, DirELISA
NBP2-24633
Species: Hu, Mu, Rt, Ch, Fe, Pm
Applications: WB
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP2-55527
Species: Hu
Applications: ICC/IF
NB100-57521
Species: Hu, Mu
Applications: WB, IP
NB100-56696
Species: Hu
Applications: WB, Flow
AF3646
Species: Hu
Applications: WB, ICC
AF2377
Species: Mu
Applications: WB, Simple Western, IHC
AF5119
Species: Hu
Applications: WB
NB200-322
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
NBP2-47428
Species: Hu
Applications: WB, IHC, IHC-P

Publications for NSD3 Antibody (NBP1-89851) (0)

There are no publications for NSD3 Antibody (NBP1-89851).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NSD3 Antibody (NBP1-89851) (0)

There are no reviews for NSD3 Antibody (NBP1-89851). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NSD3 Antibody (NBP1-89851) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NSD3 Products

Bioinformatics Tool for NSD3 Antibody (NBP1-89851)

Discover related pathways, diseases and genes to NSD3 Antibody (NBP1-89851). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NSD3 Antibody (NBP1-89851)

Discover more about diseases related to NSD3 Antibody (NBP1-89851).
 

Pathways for NSD3 Antibody (NBP1-89851)

View related products by pathway.

PTMs for NSD3 Antibody (NBP1-89851)

Learn more about PTMs related to NSD3 Antibody (NBP1-89851).
 

Research Areas for NSD3 Antibody (NBP1-89851)

Find related products by research area.

Blogs on NSD3

There are no specific blogs for NSD3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NSD3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WHSC1L1