Nrf1 Antibody (1B9)

Images

 
Western Blot: Nrf1 Antibody (1B9) [H00004899-M02] - Analysis of NRF1 expression in transfected 293T cell line by NRF1 monoclonal antibody (M02), clone 1B9.Lane 1: NRF1 transfected lysate (Predicted MW: 55.7 KDa).Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1B9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Nrf1 Antibody (1B9) Summary

Immunogen
NRF1 (NP_005002 201 a.a. - 285 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TQAQLRAFIPEMLKYSTGRGKPGWGKESCKPIWWPEDIPWANVRSDVRTEEQKQRVSWTQALRTIVKNCYKQHGREDLLYAFEDQ
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NRF1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Nrf1 Antibody (1B9)

  • Alpha palindromic-binding protein
  • ALPHA-PAL
  • EWG
  • HBZ17
  • LCR-F1
  • NFE2L1
  • Nrf1
  • NRF-1
  • nuclear respiratory factor 1
  • TCF11

Background

This gene encodes a protein that homodimerizes and functions as a transcription factor which activates the expression of some key metabolic genes regulating cellular growth and nuclear genes required for respiration, heme biosynthesis, and mitochondrial DNA transcription and replication. The protein has also been associated with the regulation of neurite outgrowth. Alternate transcriptional splice variants, which encode the same protein, have been characterized. Additional variants encoding different protein isoforms have been described but they have not been fully characterized. Confusion has occurred in bibliographic databases due to the shared symbol of NRF1 for this gene and for "nuclear factor (erythroid-derived 2)-like 1" which has an official symbol of NFE2L1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-71648
Species: Hu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-55915
Species: Hu
Applications: WB, ICC/IF
NBP1-32822
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-04676
Species: Hu, Mu, Rt, Ha, Sq
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00002551-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
MAB6799
Species: Hu
Applications: WB, IHC
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82580
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
H00055922-M06
Species: Hu
Applications: WB, ELISA
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-59438
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF

Publications for Nrf1 Antibody (H00004899-M02) (0)

There are no publications for Nrf1 Antibody (H00004899-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nrf1 Antibody (H00004899-M02) (0)

There are no reviews for Nrf1 Antibody (H00004899-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Nrf1 Antibody (H00004899-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Nrf1 Products

Bioinformatics Tool for Nrf1 Antibody (H00004899-M02)

Discover related pathways, diseases and genes to Nrf1 Antibody (H00004899-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nrf1 Antibody (H00004899-M02)

Discover more about diseases related to Nrf1 Antibody (H00004899-M02).
 

Pathways for Nrf1 Antibody (H00004899-M02)

View related products by pathway.

PTMs for Nrf1 Antibody (H00004899-M02)

Learn more about PTMs related to Nrf1 Antibody (H00004899-M02).

Blogs on Nrf1.

PGC-1 alpha: Roles in Mitochondrial Biogenesis and Disease
An important aspect of mitochondria maintenance includes biogenesis to replenish damaged and degraded mitochondrial structures. The regulation of mitochondrial biogenesis is very complex and numerous genes regulate and synchronize protein synthesis fr...  Read full blog post.

Exploring the Many Roles of PGC-1 alpha
The peroxisome proliferator-activated receptor gamma, co-activator 1 (PGC-1 alpha or PPARGC1A) gene encodes a 91 kDa nuclear protein that acts as a transcriptional co-activator involved in energy metabolism. Interaction with PPAR gamma allows it to in...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Nrf1 Antibody (1B9) and receive a gift card or discount.

Bioinformatics

Gene Symbol NRF1
Entrez
Uniprot