NRAMP2/SLC11A2/DMT1 Antibody - BSA Free

Immunohistochemistry: NRAMP2/SLC11A2/DMT1 Antibody [NBP3-35108] - Immunohistochemistry analysis of paraffin-embedded Mouse stomach using NRAMP2/SLC11A2/DMT1 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Western Blot: NRAMP2/SLC11A2/DMT1 Antibody [NBP3-35108] - Western blot analysis of various lysates using NRAMP2/SLC11A2/DMT1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 180s.

Immunohistochemistry: NRAMP2/SLC11A2/DMT1 Antibody [NBP3-35108] - Immunohistochemistry analysis of paraffin-embedded Rat stomach using NRAMP2/SLC11A2/DMT1 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NRAMP2/SLC11A2/DMT1 Antibody - BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-63 of human NRAMP2/SLC11A2/DMT1 (NP_001167597.1).
  
  Sequence:
  MVLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYFNEKISIPEEEYS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC11A2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:1000 - 1:2000
• Theoretical MW: 62 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.09% Sodium Azide
• Purity: Affinity purified

Alternate Names for NRAMP2/SLC11A2/DMT1 Antibody - BSA Free

• DCT1
• DCT1NRAMP 2
• Divalent cation transporter 1
• Divalent metal transporter 1
• DMT-1
• DMT1FLJ37416
• member 2
• NRAMP2
• NRAMP2natural resistance-associated macrophage protein 2
• SLC11A2
• solute carrier family 11 (proton-coupled divalent metal ion transporters)

Background

The SLC11A2 gene encodes a divalent metal transporter (DMT1), which carries iron, manganese, cobalt, nickel, cadmium, lead, copper, and zinc. DMT1 participates in cellular iron absorption at the luminal surface of the duodenum as well as in other areas of the body (Hubert and Hentze, 2002 [PubMed 12209011]; Ludwiczek et al., 2007 [PubMed 17293870]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for NRAMP2/SLC11A2/DMT1 Antibody (NBP3-35108). (Showing 1 - 1 of 1 FAQ).

1. Do you have a primary anti-DMT1 antibody against mouse for Western Blot?
   • We do not currently have any antibodies that we have tested against mouse for DMT1. However, if you would try one of our DMT1 antibodies against mouse, we do have an <a href="http://www.novusbio.com/support/innovators-reward.html" target="_self">Innovators Reward Program</a>.

Bioinformatics

• Gene Symbol: SLC11A2