NRAMP2/SLC11A2/DMT1 Antibody

Images

 
Western Blot: NRAMP2/SLC11A2/DMT1 Antibody [NBP1-59869] - Sample Tissue: Human Fetal Lung Antibody Dilution: 1.0 ug/ml
Western Blot: NRAMP2/SLC11A2/DMT1 Antibody [NBP1-59869] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NRAMP2/SLC11A2/DMT1 Antibody Summary

Immunogen
Synthetic peptides corresponding to SLC11A2 The peptide sequence was selected from the N terminal of SLC11A2 (NP_000608). Peptide sequence VLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYF. The peptide sequence for this immunogen was taken from within the described region.
Specificity
Specific to all four isoforms of the SLC11A2 transporter.
Predicted Species
Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC11A2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Theoretical MW
61 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control
NRAMP2/SLC11A2/DMT1 Knockout HeLa Cell Lysate
Reviewed Applications
Read 2 Reviews rated 4
using
NBP1-59869 in the following application:

Publications
Read Publications using
NBP1-59869 in the following applications:

  • WB
    2 publications

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NRAMP2/SLC11A2/DMT1 Antibody

  • DCT1
  • DCT1NRAMP 2
  • Divalent cation transporter 1
  • Divalent metal transporter 1
  • DMT-1
  • DMT1FLJ37416
  • member 2
  • NRAMP2
  • NRAMP2natural resistance-associated macrophage protein 2
  • SLC11A2
  • solute carrier family 11 (proton-coupled divalent metal ion transporters)

Background

The SLC11A2 is a divalent metal transporter (DMT1), which carries iron, manganese, cobalt, nickel, cadmium, lead, copper, and zinc. DMT1 participates in cellular iron absorption at the luminal surface of the duodenum as well as in other areas of the body.The SLC11A2 gene encodes a divalent metal transporter (DMT1), which carries iron, manganese, cobalt, nickel, cadmium, lead, copper, and zinc. DMT1 participates in cellular iron absorption at the luminal surface of the duodenum as well as in other areas of the body (Hubert and Hentze, 2002 [PubMed 12209011]; Ludwiczek et al., 2007 [PubMed 17293870]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB8400
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-21502
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NB300-914
Species: Hu, Mu
Applications: IHC, IHC-P, PEP-ELISA
NBP1-59337
Species: Hu, Mu, Bv
Applications: WB, IHC, IHC-P
H00003077-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP1-85483
Species: Hu
Applications: IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-79843
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, CyTOF-ready
NBP1-87677
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-60616
Species: Hu
NBP2-59376
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
AF8516
Species: Hu
Applications: WB, Simple Western, IP, ICC
NBP1-59869
Species: Hu, Rt
Applications: WB

Publications for NRAMP2/SLC11A2/DMT1 Antibody (NBP1-59869)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(2)
All Applications
Filter By Species
Human
(2)
All Species

Reviews for NRAMP2/SLC11A2/DMT1 Antibody (NBP1-59869) (2) 42

Average Rating: 4
(Based on 2 reviews)
We have 2 reviews tested in 2 species: Human, Mouse.

Reviews using NBP1-59869:
Filter by Applications
IHC
(1)
WB
(1)
All Applications
Filter by Species
Human
(1)
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry NRAMP2/SLC11A2/DMT1 NBP1-59869
Enlarge
3
reviewed by:
Anonymous
IHC Mouse 06/27/2017
View

Summary

ApplicationImmunohistochemistry
Sample Tested Mouse brain
SpeciesMouse
Western Blot NRAMP2/SLC11A2/DMT1 NBP1-59869
Enlarge
5
reviewed by:
Ajay Ashok
WB Human 06/13/2017
View

Summary

ApplicationWestern Blot
Sample TestedAdult brain
SpeciesHuman

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NRAMP2/SLC11A2/DMT1 Antibody (NBP1-59869). (Showing 1 - 1 of 1 FAQs).

  1. Do you have a primary anti-DMT1 antibody against mouse for Western Blot?
    • We do not currently have any antibodies that we have tested against mouse for DMT1. However, if you would try one of our DMT1 antibodies against mouse, we do have an <a href="http://www.novusbio.com/support/innovators-reward.html" target="_self">Innovators Reward Program</a>.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NRAMP2/SLC11A2/DMT1 Products

Bioinformatics Tool for NRAMP2/SLC11A2/DMT1 Antibody (NBP1-59869)

Discover related pathways, diseases and genes to NRAMP2/SLC11A2/DMT1 Antibody (NBP1-59869). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NRAMP2/SLC11A2/DMT1 Antibody (NBP1-59869)

Discover more about diseases related to NRAMP2/SLC11A2/DMT1 Antibody (NBP1-59869).
 

Pathways for NRAMP2/SLC11A2/DMT1 Antibody (NBP1-59869)

View related products by pathway.

PTMs for NRAMP2/SLC11A2/DMT1 Antibody (NBP1-59869)

Learn more about PTMs related to NRAMP2/SLC11A2/DMT1 Antibody (NBP1-59869).

Blogs on NRAMP2/SLC11A2/DMT1

There are no specific blogs for NRAMP2/SLC11A2/DMT1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
1
4
0
3
1
2
0
1
0

Anonymous
06/27/2017
Application: IHC
Species: Mouse

Ajay Ashok
06/13/2017
Application: WB
Species: Human

Bioinformatics

Gene Symbol SLC11A2
Entrez
Uniprot