Npas4 Antibody

Images

 
Immunohistochemistry: Npas4 Antibody [NBP1-88616] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Npas4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YLTFPSGPEPSLQAELSKDLVCTPPYTPHQPGGCAFLFSLHEPFQTHLPTPSSTLQEQLTPSTATFSDQLTPSSATFPDPLTSPLQGQLTETS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NPAS4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Npas4 Protein (NBP1-88616PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Npas4 Antibody

  • BHLHE79
  • bHLHe79neuronal PAS domain-containing protein 4
  • Class E basic helix-loop-helix protein 79
  • Le-PAS
  • neuronal PAS domain protein 4
  • Neuronal PAS4
  • NXFHLH-PAS transcription factor NXF
  • PASD10PAS domain-containing protein 10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-49341
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-124
Species: Hu, Mu, Rt, Bv, Ft, Pm, Sh
Applications: WB, ChIP, GS, ICC/IF, IHC, IHC-P, IP
NBP2-15049
Species: Hu
Applications: WB, ICC/IF
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP1-88623
Species: Hu
Applications: IHC, IHC-P
NBP2-01346
Species: Hu, Mu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00029107-M08
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-19614
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90286
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38401
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP1-57260
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
MAB6798
Species: Hu
Applications: WB, ICC
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00001072-M04
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
AF2086
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB100-410
Species: Hu, Mu
Applications: WB, IP
NBP1-82805
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88616
Species: Hu
Applications: IHC, IHC-P

Publications for Npas4 Antibody (NBP1-88616) (0)

There are no publications for Npas4 Antibody (NBP1-88616).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Npas4 Antibody (NBP1-88616) (0)

There are no reviews for Npas4 Antibody (NBP1-88616). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Npas4 Antibody (NBP1-88616) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Npas4 Products

Npas4 NBP1-88616

Bioinformatics Tool for Npas4 Antibody (NBP1-88616)

Discover related pathways, diseases and genes to Npas4 Antibody (NBP1-88616). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Npas4 Antibody (NBP1-88616)

Discover more about diseases related to Npas4 Antibody (NBP1-88616).
 

Pathways for Npas4 Antibody (NBP1-88616)

View related products by pathway.

PTMs for Npas4 Antibody (NBP1-88616)

Learn more about PTMs related to Npas4 Antibody (NBP1-88616).

Blogs on Npas4

There are no specific blogs for Npas4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Npas4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NPAS4