Recombinant Human NPAS2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human NPAS2 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 646 - 738 of Human NPAS2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:NLTTPASTSQDASQCQPSPDFSHDRQLRLLLSQPIQPMMPGSCDARQPSEVSRTGRQVKYAQSQTVFQNPDAHPANSSSAPMPVLLMGQAVLH

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
NPAS2
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NPAS2 Protein

  • Basic-helix-loop-helix-PAS protein MOP4
  • BHLHE9
  • bHLHe9MGC71151
  • Class E basic helix-loop-helix protein 9
  • Member of PAS protein 4
  • member of PAS superfamily 4
  • MOP4PAS domain-containing protein 4
  • neuronal PAS domain protein 2
  • neuronal PAS domain-containing protein 2
  • Neuronal PAS2
  • PASD4FLJ23138

Background

NPAS2 - neuronal PAS domain protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2288
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-125
Species: Hu
Applications: WB, ICC/IF
NB100-126
Species: Hu, Mu
Applications: WB, ChIP
NBP2-24589
Species: Hu, Mu, Rt, Bv, Eq, Pm
Applications: WB, IHC-P
NBP1-86692
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF3764
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP2-00749
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00008863-B01P
Species: Hu
Applications: WB, ICC/IF
NB100-135
Species: Hu, Pm, Bv(-), Ch(-), Rt(-), Ze(-)
Applications: WB, ICC/IF
NBP2-32423
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46005
Species: Hu
Applications: WB, IHC, IF
NBP1-88027
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-19613
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NB100-1800
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC-P, IP
H00009572-M02
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-1269
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for NPAS2 Partial Recombinant Protein (H00004862-Q01) (0)

There are no publications for NPAS2 Partial Recombinant Protein (H00004862-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NPAS2 Partial Recombinant Protein (H00004862-Q01) (0)

There are no reviews for NPAS2 Partial Recombinant Protein (H00004862-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NPAS2 Partial Recombinant Protein (H00004862-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NPAS2 Products

Bioinformatics Tool for NPAS2 Partial Recombinant Protein (H00004862-Q01)

Discover related pathways, diseases and genes to NPAS2 Partial Recombinant Protein (H00004862-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NPAS2 Partial Recombinant Protein (H00004862-Q01)

Discover more about diseases related to NPAS2 Partial Recombinant Protein (H00004862-Q01).
 

Pathways for NPAS2 Partial Recombinant Protein (H00004862-Q01)

View related products by pathway.

PTMs for NPAS2 Partial Recombinant Protein (H00004862-Q01)

Learn more about PTMs related to NPAS2 Partial Recombinant Protein (H00004862-Q01).

Blogs on NPAS2

There are no specific blogs for NPAS2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

DEC1 Antibody
NB100-1800
NPAS2 Antibody
NBP1-31363
BMAL1 Antibody
NB100-2288

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NPAS2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NPAS2