Nova2 Antibody

Images

 
Western Blot: Nova2 Antibody [NBP1-57296] - HepG2 cell lysate, concentration 2.5 ug/ml.

Product Details

Summary
Reactivity Hu, Mu, Rt, Po, Bv, Ca, Eq, GP, Rb, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Nova2 Antibody Summary

Immunogen
Synthetic peptides corresponding to NOVA2 (neuro-oncological ventral antigen 2) The peptide sequence was selected from the middle region of NOVA2. Peptide sequence EPEQVHKAVSAIVQKVQEDPQSSSCLNISYANVAGPVANSNPTGSPYASP.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NOVA2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 2.5 ug/ml
Application Notes
This is a rabbit polyclonal antibody against NOVA2 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Nova2 Antibody

  • neuro-oncological ventral antigen 2ANOVANOVA3Astrocytic NOVA1-like RNA-binding protein
  • neuro-oncological ventral antigen 3
  • RNA-binding protein Nova-2

Background

NOVA2 may regulate RNA splicing or metabolism in a specific subset of developing neurons. It binds single strand RNA.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-00221
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-2682
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready, IF
NBP2-58876PEP
Species: Hu
Applications: AC
NBP2-38661
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91744
Species: Hu
Applications: IHC, IHC-P
NBP1-56970
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Fi, GP, Rb, Ye, Ze
Applications: WB
NBP2-38049PEP
Species: Hu
Applications: AC
NB600-1081
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-51641
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC, IHC-FrFl
NB100-757
Species: Hu
Applications: WB, IHC, IHC-P, ChIP
NBP2-01808
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow
NBP1-91476
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ye, Ze
Applications: WB, Simple Western
NBP1-82761
Species: Hu
Applications: IHC, IHC-P
NBP1-88927
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33691
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for Nova2 Antibody (NBP1-57296) (0)

There are no publications for Nova2 Antibody (NBP1-57296).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nova2 Antibody (NBP1-57296) (0)

There are no reviews for Nova2 Antibody (NBP1-57296). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Nova2 Antibody (NBP1-57296) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Nova2 Products

Bioinformatics Tool for Nova2 Antibody (NBP1-57296)

Discover related pathways, diseases and genes to Nova2 Antibody (NBP1-57296). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nova2 Antibody (NBP1-57296)

Discover more about diseases related to Nova2 Antibody (NBP1-57296).
 

Pathways for Nova2 Antibody (NBP1-57296)

View related products by pathway.

PTMs for Nova2 Antibody (NBP1-57296)

Learn more about PTMs related to Nova2 Antibody (NBP1-57296).

Blogs on Nova2

There are no specific blogs for Nova2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Nova2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NOVA2
Uniprot