NOP58 Antibody [HRP]

Product Discontinued

NOP58 Antibody [HRP] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 360-529 of human NOP58 (NP_057018.1).
  
  Sequence:
  RMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDRGIRKISGTGKALAKTEKYEHKSEVKTYDPSGDSTLPTCSKKRKIEQVDKEDEITEKKAKKAKIKVKVEEEEEEKVAEEEETSVKKKKKRGKKKHIKEEPLSEEEPCTSTAIASPEKKKKKKKKRENED
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NOP58
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: PBS
• Preservative: No Preservative
• Purity: Affinity purified

Alternate Names for NOP58 Antibody [HRP]

• HSPC120
• NOL5
• NOP5/NOP58
• NOP58 ribonucleoprotein homolog (yeast)
• NOP5nucleolar protein 58
• Nucleolar protein 5
• nucleolar protein NOP5/NOP58

Background

Nop5p (a.k.a. Nop58p), is localized in the nucleolus and required for pre-18S rRNA processing in Saccharomyces cerevisiae (baker's yeast).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NOP58