Recombinant Human NOP10 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human NOP10 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 64 of Human NOLA3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKKRFKVLMTQQPRPVL

Protein/Peptide Type
Partial Recombinant Protein
Gene
NOP10

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NOP10 Protein

  • H/ACA ribonucleoprotein complex subunit 3
  • homolog of yeast Nop10p
  • MGC70651
  • NOLA3Nucleolar protein family A member 3
  • NOP10 ribonucleoprotein homolog (yeast)
  • NOP10P
  • Nucleolar protein 10
  • nucleolar protein family A, member 3 (H/ACA small nucleolar RNPs)
  • snoRNP protein NOP10

Background

This gene is a member of the H/ACA snoRNPs (small nucleolar ribonucleoproteins) gene family. snoRNPs are involved in various aspects of rRNA processing and modification and have been classified into two families: C/D and H/ACA. The H/ACA snoRNPs also include the DKC1, NOLA1 and NOLA2 proteins. These four H/ACA snoRNP proteins localize to the dense fibrillar components of nucleoli and to coiled (Cajal) bodies in the nucleus. Both 18S rRNA production and rRNA pseudouridylation are impaired if any one of the four proteins is depleted. The four H/ACA snoRNP proteins are also components of the telomerase complex. This gene encodes a protein related to Saccharomyces cerevisiae Nop10p. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13656
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85156
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31742
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84423
Species: Hu
Applications: IHC, IHC-P
NB100-317
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-57100
Species: Hu
Applications: ICC/IF
NB600-1522
Species: Hu, Mu
Applications: WB, GS, ICC/IF
NBP1-89306
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-68252
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, KO
NBP1-71770
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-230
Species: Hu
Applications: WB, IP, PLA
NBP1-82268
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB100-233
Species: Hu
Applications: WB, PLA
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
H00055505-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for NOP10 Partial Recombinant Protein (H00055505-Q01) (0)

There are no publications for NOP10 Partial Recombinant Protein (H00055505-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NOP10 Partial Recombinant Protein (H00055505-Q01) (0)

There are no reviews for NOP10 Partial Recombinant Protein (H00055505-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NOP10 Partial Recombinant Protein (H00055505-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NOP10 Products

Bioinformatics Tool for NOP10 Partial Recombinant Protein (H00055505-Q01)

Discover related pathways, diseases and genes to NOP10 Partial Recombinant Protein (H00055505-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NOP10 Partial Recombinant Protein (H00055505-Q01)

Discover more about diseases related to NOP10 Partial Recombinant Protein (H00055505-Q01).
 

Pathways for NOP10 Partial Recombinant Protein (H00055505-Q01)

View related products by pathway.

PTMs for NOP10 Partial Recombinant Protein (H00055505-Q01)

Learn more about PTMs related to NOP10 Partial Recombinant Protein (H00055505-Q01).
 

Research Areas for NOP10 Partial Recombinant Protein (H00055505-Q01)

Find related products by research area.

Blogs on NOP10

There are no specific blogs for NOP10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

NOP10 Antibody
NBP2-32441

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NOP10 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NOP10