non-muscle heavy chain 10 Myosin Antibody - BSA Free Summary
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1908-2007 of human non-muscle heavy chain 10 Myosin (NP_001242941.1).
Sequence: ARMKQLKRQLEEAEEEATRANASRRKLQRELDDATEANEGLSREVSTLKNRLRRGGPISFSSSRSGRRQLHLEGASLELSDDDTESKTSDVNETQPPQSE |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
MYH10 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Western Blot 1:500 - 1:2000
|
| Theoretical MW |
229 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.01% Thimerosal |
| Purity |
Affinity purified |
Alternate Names for non-muscle heavy chain 10 Myosin Antibody - BSA Free
Background
Myosin II is a hexameric protein that consist of a pair of heavy chain subunits (MHC), a pair of essential light chain subunits (MLC), and a pair of regulatory light chain subunits (RLCs). Non-muscle myosin heavy chain II-B is encoded by the myosin heavy chain 10 gene (MYH10) and non-muscle myosin heavy chain II-A is encoded by the Myosin heavy chain 9 gene (MYH9). Myosin in non-muscle cells is involved in motile cellular processes which include cytokinesis, cell shape, secrection, and capping. Alternate names for Myosin-10 is Myosin heavy chain II-B, cellular myosin heavy chain type B, and NMMHCB.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: All-Multi
Applications: Flow, ICC, IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, WB
Species: Mu, Rt
Applications: ICC/IF, WB
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IP, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: WB, ELISA
Publications for non-muscle heavy chain 10 Myosin Antibody (NBP3-35203) (0)
There are no publications for non-muscle heavy chain 10 Myosin Antibody (NBP3-35203).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for non-muscle heavy chain 10 Myosin Antibody (NBP3-35203) (0)
There are no reviews for non-muscle heavy chain 10 Myosin Antibody (NBP3-35203).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for non-muscle heavy chain 10 Myosin Antibody (NBP3-35203) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional non-muscle heavy chain 10 Myosin Products
Blogs on non-muscle heavy chain 10 Myosin