non-muscle heavy chain 10 Myosin Antibody - BSA Free

Western Blot: non-muscle heavy chain 10 Myosin Antibody [NBP3-35203] - Western blot analysis of various lysates using non-muscle heavy chain 10 Myosin Rabbit pAb at 1:3000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

non-muscle heavy chain 10 Myosin Antibody - BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1908-2007 of human non-muscle heavy chain 10 Myosin (NP_001242941.1).
  
  Sequence:
  ARMKQLKRQLEEAEEEATRANASRRKLQRELDDATEANEGLSREVSTLKNRLRRGGPISFSSSRSGRRQLHLEGASLELSDDDTESKTSDVNETQPPQSE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MYH10
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 229 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for non-muscle heavy chain 10 Myosin Antibody - BSA Free

• cellular myosin heavy chain, type B type B
• Cellular myosin heavy chain, type B
• heavy polypeptide 10, non-muscle
• MGC134913
• MGC134914
• MYH10
• Myosin heavy chain 10
• Myosin heavy chain, non-muscle IIb
• myosin heavy chain, nonmuscle type B
• myosin, heavy chain 10, non-muscle
• myosin-10
• near to the ATP binding region
• NMMHC II-b
• NMMHCB
• NMMHC-B
• NMMHC-IIB
• non-muscle heavy chain 10 Myosin
• Non-muscle myosin heavy chain B
• nonmuscle myosin heavy chain IIB
• Non-muscle myosin heavy chain IIb
• nonmuscle myosin heavy chain-B
• nonmuscle myosin II heavy chain-B

Background

Myosin II is a hexameric protein that consist of a pair of heavy chain subunits (MHC), a pair of essential light chain subunits (MLC), and a pair of regulatory light chain subunits (RLCs). Non-muscle myosin heavy chain II-B is encoded by the myosin heavy chain 10 gene (MYH10) and non-muscle myosin heavy chain II-A is encoded by the Myosin heavy chain 9 gene (MYH9). Myosin in non-muscle cells is involved in motile cellular processes which include cytokinesis, cell shape, secrection, and capping. Alternate names for Myosin-10 is Myosin heavy chain II-B, cellular myosin heavy chain type B, and NMMHCB.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MYH10