NOLC1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: NOLC1 Antibody [NBP1-83058] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli.
Immunohistochemistry-Paraffin: NOLC1 Antibody [NBP1-83058] - Staining of human cerebral cortex shows moderate nucleolar positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NOLC1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VPSDLYPLVLGFLRDNQLSEVANKFAKATGATQQDANASSLLDIYSFWLKSAKVPERKLQANGPVAKKAKKK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NOLC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NOLC1 Protein (NBP1-83058PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NOLC1 Antibody

  • 140 kDa nucleolar phosphoprotein
  • HCV NS5A trans-regulated protein 13
  • HCV NS5A-transactivated protein 13
  • Hepatitis C virus NS5A-transactivated protein 13
  • KIAA0035NS5ATP13
  • NOPP130
  • NOPP140
  • Nucleolar 130 kDa protein
  • nucleolar and coiled-body phosphoprotein 1
  • nucleolar and coiled-body phosphprotein 1
  • Nucleolar phosphoprotein p130
  • nucleolar protein p130
  • P130

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33735
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-82455
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00532
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-21374
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00001434-M08
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB600-210
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-26616
Species: Hu
Applications: WB, IP
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
AF4259
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF1555
Species: Hu
Applications: WB
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83058
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for NOLC1 Antibody (NBP1-83058) (0)

There are no publications for NOLC1 Antibody (NBP1-83058).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NOLC1 Antibody (NBP1-83058) (0)

There are no reviews for NOLC1 Antibody (NBP1-83058). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NOLC1 Antibody (NBP1-83058) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NOLC1 Products

Bioinformatics Tool for NOLC1 Antibody (NBP1-83058)

Discover related pathways, diseases and genes to NOLC1 Antibody (NBP1-83058). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NOLC1 Antibody (NBP1-83058)

Discover more about diseases related to NOLC1 Antibody (NBP1-83058).
 

Pathways for NOLC1 Antibody (NBP1-83058)

View related products by pathway.

PTMs for NOLC1 Antibody (NBP1-83058)

Learn more about PTMs related to NOLC1 Antibody (NBP1-83058).
 

Research Areas for NOLC1 Antibody (NBP1-83058)

Find related products by research area.

Blogs on NOLC1

There are no specific blogs for NOLC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NOLC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NOLC1