NOLC1 Antibody


Western Blot: NOLC1 Antibody [NBP1-58200] - NOLC1 antibody - C-terminal region validated by WB using HepG2 cell lysate at 2.5ug/ml.
Immunocytochemistry/ Immunofluorescence: NOLC1 Antibody [NBP1-58200] - Zebrafish kidney, 1:250 Image Submitted By: James Lister Virginia Commonwealth University
Immunohistochemistry-Paraffin: NOLC1 Antibody [NBP1-58200] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

Product Details

Reactivity Hu, ZeSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

NOLC1 Antibody Summary

Synthetic peptides corresponding to NOLC1(nucleolar and coiled-body phosphoprotein 1) The peptide sequence was selected from the C terminal of NOLC1. Peptide sequence DNSFDAKRGAAGDWGERANQVLKFTKGKSFRHEKTKKKRGSYRGGSISVQ.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence 1:10-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against NOLC1 and was validated on Western Blot and immunohistochemistry-paraffin

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NOLC1 Antibody

  • 140 kDa nucleolar phosphoprotein
  • HCV NS5A trans-regulated protein 13
  • HCV NS5A-transactivated protein 13
  • Hepatitis C virus NS5A-transactivated protein 13
  • KIAA0035NS5ATP13
  • NOPP130
  • NOPP140
  • Nucleolar 130 kDa protein
  • nucleolar and coiled-body phosphoprotein 1
  • nucleolar and coiled-body phosphprotein 1
  • Nucleolar phosphoprotein p130
  • nucleolar protein p130
  • P130


Related to nucleologenesis, NOLC1 may play a role in the maintenance of the fundamental structure of the fibrillar center and dense fibrillar component in the nucleolus. It has intrinsic GTPase and ATPase activities. NOLC1 may play an important role in transcription catalyzed by RNA polymerase I.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Ca
Applications: WB, IHC
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
Species: Hu
Applications: WB, IP
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC
Species: Hu, Rt
Applications: WB, ELISA
Species: Hu, Ze
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NOLC1 Antibody (NBP1-58200) (0)

There are no publications for NOLC1 Antibody (NBP1-58200).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NOLC1 Antibody (NBP1-58200) (0)

There are no reviews for NOLC1 Antibody (NBP1-58200). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NOLC1 Antibody (NBP1-58200) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional NOLC1 Products

Bioinformatics Tool for NOLC1 Antibody (NBP1-58200)

Discover related pathways, diseases and genes to NOLC1 Antibody (NBP1-58200). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NOLC1 Antibody (NBP1-58200)

Discover more about diseases related to NOLC1 Antibody (NBP1-58200).

Pathways for NOLC1 Antibody (NBP1-58200)

View related products by pathway.

PTMs for NOLC1 Antibody (NBP1-58200)

Learn more about PTMs related to NOLC1 Antibody (NBP1-58200).

Research Areas for NOLC1 Antibody (NBP1-58200)

Find related products by research area.

Blogs on NOLC1

There are no specific blogs for NOLC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NOLC1 Antibody and receive a gift card or discount.


Gene Symbol NOLC1