Home » NOLC1 » NOLC1 Antibodies » NOLC1 Antibody

NOLC1 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: NOLC1 Antibody [NBP1-58200] - NOLC1 antibody - C-terminal region validated by WB using HepG2 cell lysate at 2.5ug/ml.
Western Blot: NOLC1 Antibody [NBP1-58200] - NOLC1 antibody - C-terminal region validated by WB using HepG2 cell lysate at 2.5ug/ml.
Immunocytochemistry/ Immunofluorescence: NOLC1 Antibody [NBP1-58200] - Zebrafish kidney, 1:250 Image Submitted By: James Lister Virginia Commonwealth University
Immunohistochemistry-Paraffin: NOLC1 Antibody [NBP1-58200] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

Product Details

Summary
Reactivity Hu, ZeSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

NOLC1 Antibody Summary

Immunogen
Synthetic peptides corresponding to NOLC1(nucleolar and coiled-body phosphoprotein 1) The peptide sequence was selected from the C terminal of NOLC1. Peptide sequence: DNSFDAKRGAAGDWGERANQVLKFTKGKSFRHEKTKKKRGSYRGGSISVQ. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NOLC1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1:10-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against NOLC1 and was validated on Western Blot and immunohistochemistry-paraffin

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NOLC1 Antibody

  • 140 kDa nucleolar phosphoprotein
  • HCV NS5A trans-regulated protein 13
  • HCV NS5A-transactivated protein 13
  • Hepatitis C virus NS5A-transactivated protein 13
  • KIAA0035NS5ATP13
  • NOPP130
  • NOPP140
  • Nucleolar 130 kDa protein
  • nucleolar and coiled-body phosphoprotein 1
  • nucleolar and coiled-body phosphprotein 1
  • Nucleolar phosphoprotein p130
  • nucleolar protein p130
  • P130

Background

Related to nucleologenesis, NOLC1 may play a role in the maintenance of the fundamental structure of the fibrillar center and dense fibrillar component in the nucleolus. It has intrinsic GTPase and ATPase activities. NOLC1 may play an important role in transcription catalyzed by RNA polymerase I.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

p107 Antibody
NBP2-33735
Immunocytochemistry/Immunofluorescence: p107 Antibody [NBP2-33735] - Immunofluorescent staining of human cell line HeLa shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: p107 Antibody [NBP2-33735] - Staining of human testis shows moderate nuclear postivity in cells in seminiferous ducts and Leydig cells.
Immunohistochemistry-Paraffin: p107 Antibody [NBP2-33735] - Staining of human colon shows moderate nuclear positivity in glanular cells.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
RB1 Antibody
(172C1094) - (cleaved
NB100-56598
Knockdown Validated: RB1 Antibody (172C1094) - (cleaved) [NB100-56598] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and RB-1 knockout (KO) HeLa cell line. PVDF membrane was probed with 2 ug/ml of Mouse Anti-Human RB-1 Monoclonal Antibody (Catalog # NB100-56598) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog #HAF018). Specific band was detected for RB-1 at approximately 60 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Immunohistochemistry: cleaved Retinoblastoma 1 Antibody (172C1094) [NB100-56598] - Analysis in sections of primary human breast tumors. Image courtesy of Dr. Macleod, The Ben May Institute for Cancer Research, and The University of Chicago.
Western Blot: cleaved Retinoblastoma 1 Antibody (172C1094) [NB100-56598] - Analysis in HL60 cells were treated with camptothecin for 24 hours.
(2 Publications)
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P, KD, WB
p130 Antibody
NBP1-82455
Immunohistochemistry-Paraffin: p130 Antibody [NBP1-82455] - Staining of human cerebellum shows strong nuclear positivity in Purkinje cells and cells in granular and molecular layer.
Immunohistochemistry-Paraffin: p130 Antibody [NBP1-82455] - Staining of human endometrium shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: p130 Antibody [NBP1-82455] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
p130Cas/BCAR1
Antibody (OTI1A9)
NBP2-00532
Flow Cytometry: BCAR1 Antibody (1A9) [NBP2-00532] - Analysis of Hela cells, using anti-BCAR1 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: BCAR1 Antibody (1A9) [NBP2-00532] - Analysis of Jurkat cells, using anti-BCAR1 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: BCAR1 Antibody (1A9) [NBP2-00532] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-BCAR1 antibody, and then analyzed by flow cytometry.
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
E2F-4 Antibody
NBP1-21374
Immunoprecipitation: E2F-4 Antibody [NBP1-21374] - Detection of human E2F4 by western blot of immunoprecipitates. Samples: Whole cell lysate (0.5 or 1.0 mg per IP reaction; 20% of IP loaded) from HEK293T cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-E2F4 antibody NBP1-21374 used for IP at 6 ug per reaction. E2F4 was also immunoprecipitated by another rabbit anti-E2F4 antibody. For blotting immunoprecipitated E2F4, NBP1-21374 was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 10 seconds.
Knockdown Validated: E2F-4 Antibody [NBP1-21374] - Immunoblots of indicated proteins in OVCAR-8 and PEA1 cells transfected with control luciferase (Luc) and two independent E2F-4 siRNAs. Image collected and cropped by CiteAb from the following publication (https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6789141/) licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: E2F-4 Antibody [NBP1-21374] - Sample: FFPE section of human prostate carcinoma. Antibody: Affinity purified rabbit anti-E2F4 used at a dilution of 1:1,000 (1ug/ml). Detection: DAB
(2 Publications)
Species: Hu
Applications: IHC, IHC-P, IP, KD, WB
FAK Antibody
(SR46-04)
NBP2-67327
Flow Cytometry: FAK Antibody (SR46-04) [NBP2-67327] - Analysis of Hela cells with FAK antibody at 1/50 dilution (blue) compared with an unlabelled control (cells without incubation with primary antibody; red). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunocytochemistry/Immunofluorescence: FAK Antibody (SR46-04) [NBP2-67327] - Staining FAK in SH-SY-5Y cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: FAK Antibody (SR46-04) [NBP2-67327] - Analysis of paraffin-embedded human spleen tissue using anti-FAK antibody. Counter stained with hematoxylin.
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin: p21/CIP1/CDKN1A Antibody (WA-1) [NBP2-29463] - Formalin-fixed, paraffin-embedded human bladder carcinoma stained with p21 Monoclonal Antibody (WA-1).
(15 Publications)
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
p120-catenin
Antibody (OTI2E8)
NBP2-45646
Immunohistochemistry: p120-catenin Antibody (2E8) [NBP2-45646] - Analysis of Carcinoma of Human kidney tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Immunohistochemistry: p120-catenin Antibody (2E8) [NBP2-45646] - Analysis of Carcinoma of Human prostate tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Immunohistochemistry: p120-catenin Antibody (2E8) [NBP2-45646] - Analysis of Human colon tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, WB

CSE1L/CAS/Exportin-2 A
H00001434-M08
Western Blot: CSE1L/CAS/Exportin-2 Antibody (3D8) [H00001434-M08] - Analysis of CSE1L expression in Hela S3 NE (Cat # L013V3).
Immunohistochemistry-Paraffin: CSE1L/CAS/Exportin-2 Antibody (3D8) [H00001434-M08] - Mouse prostate tissue section stained with primary antibody for 10 hrs. IHC-P image submitted by a verified customer review.
ELISA: CSE1L/CAS/Exportin-2 Antibody (3D8) [H00001434-M08] - Detection limit for recombinant GST tagged CSE1L is approximately 3ng/ml as a capture antibody.
(1 Review)
(13 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
E2F-1 Antibody
(JJ092-02)
NBP2-67899
Flow Cytometry: E2F-1 Antibody (JJ092-02) [NBP2-67899] - Analysis of Hela cells with E2F1 antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunocytochemistry/Immunofluorescence: E2F-1 Antibody (JJ092-02) [NBP2-67899] - Staining E2F1 in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: E2F-1 Antibody (JJ092-02) [NBP2-67899] - Staining E2F1 in HepG2 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Retinoblastoma
binding protein 1 Ant ...
NBP1-26616
Western Blot: Retinoblastoma binding protein 1 Antibody [NBP1-26616] - Detection of human ARID4A by western blot. Samples: Whole cell lysate (50 ug) from HeLa and HEK293T cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-ARID4A antibody NBP1-26616 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Immunoprecipitation: Retinoblastoma binding protein 1 Antibody [NBP1-26616] - Detection of human ARID4A by western blot of immunoprecipitates. Samples: Whole cell lysate (1.0 mg per IP reaction; 20% of IP loaded) from HeLa cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-ARID4A antibody NBP1-26616 used for IP at 3 ug per reaction. ARID4A was also immunoprecipitated by another rabbit anti-ARID4A antibody. For blotting immunoprecipitated ARID4A, NBP1-26616 was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
Species: Hu
Applications: IP, WB
CDK2 Antibody
(OTI2D9)
NBP2-00776
Flow Cytometry: Cdk2 Antibody (2D9) [NBP2-00776] - Analysis of Hela cells, using anti-Cdk2 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: Cdk2 Antibody (2D9) [NBP2-00776] - Analysis of Jurkat cells, using anti-Cdk2 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: Cdk2 Antibody (2D9) [NBP2-00776] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-Cdk2 antibody, and then analyzed by flow cytometry.
(1 Review)
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Paxillin Antibody
(SY23-02)
NBP2-67427
Immunocytochemistry/Immunofluorescence: Paxillin Antibody (SY23-02) [NBP2-67427] - Staining Paxillin in A549 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: Paxillin Antibody (SY23-02) [NBP2-67427] - Staining Paxillin in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: Paxillin Antibody (SY23-02) [NBP2-67427] - Staining Paxillin in SKOV-3 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western blot shows lysates of MDA‑MB‑468 human breast cancer cell line and HepG2 human hepatocellular carcinoma cell line untreated (-) or treated (+) with 50 μM pervanadate (PV) for 10 minutes. PVDF membrane was probed with 1 µg/mL of Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Src (Y419) at approximately 56 - 61 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MBA‑MB‑468 human breast cancer cell line untreated (-) or treated (+) with 50 µM Pervanadate (PV) for 10 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Src (Y419) at approximately 64 kDa (as indicated) using 10 µg/mL of Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Src phosphorylated at Y419 was detected in immersion fixed paraffin-embedded sections of human colon using Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rabbit HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS005) and counterstained with hematoxylin (blue). Specific labeling was localized to the cytoplasm of epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Review)
(6 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on A549 cells with p53 (PAb240) NB200-103AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Flow (Intracellular): p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103 (blue) and a matched isotype control NBP2-27287 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by APC-conjugated anti-mouse IgG secondary antibody F0101B.
(3 Reviews)
(33 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
p19ARF/CDKN2A
Antibody - BSA Free
NB200-106
Immunohistochemistry: p19ARF/CDKN2A Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
Western Blot: p19ARF/CDKN2A Antibody [NB200-106] - Analysis of p19ARF/CDKN2A in (A) NIH/3T3 and (B) MEF cells.
Immunocytochemistry/Immunofluorescence: p19ARF/CDKN2A Antibody [NB200-106] - Antibody was tested in MEF cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
(1 Review)
(46 Publications)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
p27/Kip1 [p
Thr157] Antibody
AF1555
Western blot shows lysates of MCF-7 human breast cancer cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF-I (Catalog # 291‑G1) for 20 minutes. PVDF membrane was probed with 0.5 µg/mL Human Phospho-p27/Kip1 (T157) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1555) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band for Phospho-p27/Kip1 (T157) was detected at approximately 27 kDa (as indicated). The phospho-specificity of this antibody was supported by decreased labeling following treatment with 600 U lambda -phosphatase ( lambda -PPase) for 1 hour. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
(12 Publications)
Species: Hu
Applications: WB
TCEAL1 Antibody
(OTI2G10)
NBP2-46085
Immunohistochemistry: TCEAL1 Antibody (2G10) [NBP2-46085] - Analysis of Human Ovary tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)
Immunohistochemistry: TCEAL1 Antibody (2G10) [NBP2-46085] - Analysis of Human pancreas tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)
Immunohistochemistry: TCEAL1 Antibody (2G10) [NBP2-46085] - Analysis of Carcinoma of Human thyroid tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)
Species: Hu
Applications: IHC, WB
D4S234E Antibody
(1C3)
H00027065-M01
Sandwich ELISA: D4S234E Antibody (1C3) [H00027065-M01] - Detection limit for recombinant GST tagged D4S234E is approximately 0.1ng/ml as a capture antibody.
Western Blot: D4S234E Antibody (1C3) [H00027065-M01] - D4S234E monoclonal antibody (M01), clone 1C3. Analysis of D4S234E expression in PC-12.
Western Blot: D4S234E Antibody (1C3) [H00027065-M01] - D4S234E monoclonal antibody (M01), clone 1C3. Analysis of D4S234E expression in rat brain.
(1 Publication)
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NOLC1 Antibody
NBP1-58200
NOLC1 Antibody
Species: Hu, Ze
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NOLC1 Antibody (NBP1-58200) (0)

There are no publications for NOLC1 Antibody (NBP1-58200).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NOLC1 Antibody (NBP1-58200) (0)

There are no reviews for NOLC1 Antibody (NBP1-58200). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NOLC1 Antibody (NBP1-58200) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NOLC1 Products

Bioinformatics Tool for NOLC1 Antibody (NBP1-58200)

Discover related pathways, diseases and genes to NOLC1 Antibody (NBP1-58200). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NOLC1 Antibody (NBP1-58200)

Discover more about diseases related to NOLC1 Antibody (NBP1-58200).
 

Pathways for NOLC1 Antibody (NBP1-58200)

View related products by pathway.

PTMs for NOLC1 Antibody (NBP1-58200)

Learn more about PTMs related to NOLC1 Antibody (NBP1-58200).
 

Research Areas for NOLC1 Antibody (NBP1-58200)

Find related products by research area.

Blogs on NOLC1

There are no specific blogs for NOLC1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NOLC1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol NOLC1
Uniprot