NOLC1 Antibody Summary
Immunogen |
Synthetic peptides corresponding to NOLC1(nucleolar and coiled-body phosphoprotein 1) The peptide sequence was selected from the C terminal of NOLC1. Peptide sequence: DNSFDAKRGAAGDWGERANQVLKFTKGKSFRHEKTKKKRGSYRGGSISVQ. The peptide sequence for this immunogen was taken from within the described region. |
Predicted Species |
Mouse (100%), Rat (100%), Canine (100%), Goat (100%), Equine (100%), Yeast (92%), Rabbit (100%), Guinea Pig (100%), Bovine (100%). Backed by our 100% Guarantee. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
NOLC1 |
Purity |
Protein A purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Western Blot 1:100-1:2000
- Immunocytochemistry/Immunofluorescence 1:10-1:500
- Immunohistochemistry 1:10-1:500
- Immunohistochemistry-Paraffin 1:10-1:500
|
Application Notes |
This is a rabbit polyclonal antibody against NOLC1 and was validated on Western Blot and immunohistochemistry-paraffin |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS and 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Purity |
Protein A purified |
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for NOLC1 Antibody
Background
Related to nucleologenesis, NOLC1 may play a role in the maintenance of the fundamental structure of the fibrillar center and dense fibrillar component in the nucleolus. It has intrinsic GTPase and ATPase activities. NOLC1 may play an important role in transcription catalyzed by RNA polymerase I.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IP
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Ch, Pm, Rb, RM, Xp, Ze
Applications: WB, ICC/IF
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
Species: Hu, Ze, Mu, Rt, Bv, Ca, Eq, Gt, Gp, Rb, Ye
Applications: WB, ICC/IF, IHC, IHC-P
Publications for NOLC1 Antibody (NBP1-58200) (0)
There are no publications for NOLC1 Antibody (NBP1-58200).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for NOLC1 Antibody (NBP1-58200) (0)
There are no reviews for NOLC1 Antibody (NBP1-58200).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for NOLC1 Antibody (NBP1-58200) (0)
Secondary Antibodies
| |
Isotype Controls
|
Other Available Formats
Additional NOLC1 Products
Bioinformatics Tool for NOLC1 Antibody (NBP1-58200)
Discover related pathways, diseases and genes to NOLC1 Antibody (NBP1-58200). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for NOLC1 Antibody (NBP1-58200)
Discover more about diseases related to NOLC1 Antibody (NBP1-58200).
| | Pathways for NOLC1 Antibody (NBP1-58200)
View related products by pathway.
|
PTMs for NOLC1 Antibody (NBP1-58200)
Learn more about PTMs related to NOLC1 Antibody (NBP1-58200).
| | Research Areas for NOLC1 Antibody (NBP1-58200)
Find related products by research area.
|
Blogs on NOLC1