Home » NOLC1 » NOLC1 Antibodies » NOLC1 Antibody

NOLC1 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: NOLC1 Antibody [NBP1-58200] - NOLC1 antibody - C-terminal region validated by WB using HepG2 cell lysate at 2.5ug/ml.
Western Blot: NOLC1 Antibody [NBP1-58200] - NOLC1 antibody - C-terminal region validated by WB using HepG2 cell lysate at 2.5ug/ml.
Immunocytochemistry/ Immunofluorescence: NOLC1 Antibody [NBP1-58200] - Zebrafish kidney, 1:250 Image Submitted By: James Lister Virginia Commonwealth University
Immunohistochemistry-Paraffin: NOLC1 Antibody [NBP1-58200] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

Product Details

Summary
Reactivity Hu, ZeSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

NOLC1 Antibody Summary

Immunogen
Synthetic peptides corresponding to NOLC1(nucleolar and coiled-body phosphoprotein 1) The peptide sequence was selected from the C terminal of NOLC1. Peptide sequence DNSFDAKRGAAGDWGERANQVLKFTKGKSFRHEKTKKKRGSYRGGSISVQ.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NOLC1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence 1:10-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against NOLC1 and was validated on Western Blot and immunohistochemistry-paraffin

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NOLC1 Antibody

  • 140 kDa nucleolar phosphoprotein
  • HCV NS5A trans-regulated protein 13
  • HCV NS5A-transactivated protein 13
  • Hepatitis C virus NS5A-transactivated protein 13
  • KIAA0035NS5ATP13
  • NOPP130
  • NOPP140
  • Nucleolar 130 kDa protein
  • nucleolar and coiled-body phosphoprotein 1
  • nucleolar and coiled-body phosphprotein 1
  • Nucleolar phosphoprotein p130
  • nucleolar protein p130
  • P130

Background

Related to nucleologenesis, NOLC1 may play a role in the maintenance of the fundamental structure of the fibrillar center and dense fibrillar component in the nucleolus. It has intrinsic GTPase and ATPase activities. NOLC1 may play an important role in transcription catalyzed by RNA polymerase I.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

p107 Antibody
NBP2-33735
Western Blot: p107 Antibody [NBP2-33735] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/Immunofluorescence: p107 Antibody [NBP2-33735] - Immunofluorescent staining of human cell line HeLa shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: p107 Antibody [NBP2-33735] - Staining in human lymph node and pancreas tissues using anti-RBL1 antibody. Corresponding RBL1 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
cleaved
Retinoblastoma 1 Anti ...
NB100-56598
Western Blot: cleaved Retinoblastoma 1 Antibody (172C1094) [NB100-56598] - Analysis in HL60 cells were treated with camptothecin for 24 hours.
Immunohistochemistry: cleaved Retinoblastoma 1 Antibody (172C1094) [NB100-56598] - Analysis in sections of primary human breast tumors. Image courtesy of Dr. Macleod, The Ben May Institute for Cancer Research, and The University of Chicago.
(2 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
p130 Antibody
NBP1-82455
Western Blot: p130 Antibody [NBP1-82455] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/Immunofluorescence: p130 Antibody [NBP1-82455] - Staining of human cell line A-431 shows localization to nucleus & nucleoli.
Immunohistochemistry-Paraffin: p130 Antibody [NBP1-82455] - Staining of human kidney shows nuclear positivity both in tubules and in glomeruli.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
p130Cas/BCAR1
Antibody (OTI1A9)
NBP2-00532
Western Blot: BCAR1 Antibody (1A9) [NBP2-00532] Analysis of extracts (35ug) from 9 different cell lines by using anti-BCAR1 monoclonal antibody.
Immunocytochemistry/Immunofluorescence: BCAR1 Antibody (1A9) [NBP2-00532] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY BCAR1.
Immunohistochemistry-Paraffin: BCAR1 Antibody (1A9) [NBP2-00532] - Staining of paraffin-embedded Carcinoma of Human pancreas tissue using anti-BCAR1 mouse monoclonal antibody.
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
E2F-4 Antibody
NBP1-21374
Western Blot: E2F-4 Antibody [NBP1-21374] - Detection of Human E2F4 by Western Blot. Samples: Whole cell lysate from HeLa (5, 15, 50 ug) and 293T (50ug) cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-E2F4 antibody NBP1-21374 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
Immunohistochemistry: E2F-4 Antibody [NBP1-21374] - Sample: FFPE section of human prostate carcinoma. Antibody: Affinity purified rabbit anti-E2F4 used at a dilution of 1:1,000 (1ug/ml). Detection: DAB
Western Blot: E2F-4 Antibody [NBP1-21374] - Whole cell lysate from HeLa (5, 15 and 50 mcg for WB; 1 mg for IP, 20% of IP loaded), 293T (T; 50 mcg) and mouse NIH3T3 (M; 50mcg) cells. NBP1-21374 used for WB at 0.1 mcg/ml (A) and 1 mcg/ml (B) and used for IP at 10 mcg/mg lysate. E2F4 was also immunoprecipitated by NBP1-21373, which recognizes an upstream epitope.
(1 Publication)
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
FAK Antibody
(OTI4D11)
NBP2-45923
Western Blot: FAK Antibody (4D11) [NBP2-45923] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY FAK.
Immunocytochemistry/Immunofluorescence: FAK Antibody (OTI4D11) [NBP2-45923] - FAK Antibody (4D11) [NBP2-45923] - Analysis of HeLa cells.
Immunohistochemistry: FAK Antibody (4D11) [NBP2-45923] - Analysis of Carcinoma of Human pancreas tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
p21/CIP1/CDKN1A
Antibody (WA-1 (HJ21)
NBP2-29463
Immunohistochemistry-Paraffin: p21/CIP1/CDKN1A Antibody (WA-1 (HJ21)) [NBP2-29463] - Formalin-fixed, paraffin-embedded human bladder carcinoma stained with p21 Monoclonal Antibody (WA-1).
(11 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
p120-catenin
Antibody (OTI2E8)
NBP2-45646
Western Blot: p120-catenin Antibody (2E8) [NBP2-45646] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY p120-catenin.
Immunohistochemistry: p120-catenin Antibody (2E8) [NBP2-45646] - Analysis of Carcinoma of Human bladder tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Western Blot: p120-catenin Antibody (2E8) [NBP2-45646] - Analysis of extracts (35ug) from 9 different cell lines by using CTNND1 monoclonal antibody (HepG2: human; HeLa: human; SVT2: mouse; A549: human; COS7: monkey; Jurkat: human; MDCK: canine; PC12: rat; MCF7: human). Dilution: 1:2000
Species: Hu, Ca
Applications: WB, IHC

CSE1L/CAS/Exportin-2 A
H00001434-M08
Western Blot: CSE1L/CAS/Exportin-2 Antibody (3D8) [H00001434-M08] - Analysis of CSE1L expression in Hela S3 NE (Cat # L013V3).
Immunocytochemistry/Immunofluorescence: CSE1L/CAS/Exportin-2 Antibody (3D8) [H00001434-M08] - Analysis of monoclonal antibody to CSE1L on HeLa cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: CSE1L/CAS/Exportin-2 Antibody (3D8) [H00001434-M08] - Analysis of monoclonal antibody to CSE1L on formalin-fixed paraffin-embedded human prostate. Antibody concentration 3 ug/ml
(11 Publications)
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
E2F-1 Antibody
(8G9)
NBP2-37474
Western Blot: E2F-1 Antibody (8G9) [NBP2-37474] - Western blot analysis using E2F1 mouse mAb against HeLa (1), SK-N-SH (2), and NIH3T3 (3) cell lysate.
Immunohistochemistry: E2F-1 Antibody (8G9) [NBP2-37474] - Immunohistochemical analysis of paraffin-embedded rectum cancer tissues using E2F1 mouse mAb with DAB staining.
Flow Cytometry: E2F-1 Antibody (8G9) [NBP2-37474] - Flow cytometric analysis of HeLa cells using E2F1 mouse mAb (green) and negative control (red).
(1 Publication)
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
Retinoblastoma
binding protein 1 Ant ...
NBP1-26616
Western Blot: Retinoblastoma binding protein 1 Antibody [NBP1-26616] - Whole cell lysate from HeLa cells. ARID4A was also immunoprecipitated by rabbit anti-ARID4A antibody NBP1-26617.
Species: Hu
Applications: WB, IP
CDK2 Antibody (1A6)
NBP2-37507
Western Blot: CDK2 Antibody (1A6) [NBP2-37507] - Western blot analysis using CDK2 mouse mAb against Jurkat (1), HL-60 (2), K562(3), A431(4), HeLa(5), and NIH3T3 (6) cell lysate.
Immunocytochemistry/Immunofluorescence: CDK2 Antibody (1A6) [NBP2-37507] - Immunofluorescence analysis of HeLa cells using CDK2 mouse mAb (green). Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry: CDK2 Antibody (1A6) [NBP2-37507] - Immunohistochemical analysis of paraffin-embedded colon cancer tissues using CDK2 mouse mAb with DAB staining.
(1 Review)
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Paxillin Antibody
[Unconjugated]
AF4259
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line, CCD‑1070Sk human foreskin fibroblast cell line, A431 human epithelial carcinoma cell line, HepG2 human hepatocellular carcinoma cell line, and MCF-7 human breast cancer cell line. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human/Mouse/Rat Paxillin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4259) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific diffuse band was detected for Paxillin at approximately 65 to 70 kDa (as indicated). This experiment was conducted using Immunoblot Buffer Group 1.
Paxillin was detected in immersion fixed HUVEC human umbilical vein endothelial cells using Sheep Anti-Human/Mouse/Rat Paxillin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4259) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Sheep IgG Secondary Antibody (red; Catalog # NL010) and counterstained with DAPI (blue). Specific staining was localized to actin filament tips and cytosol. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line and MCF‑7 human breast cancer cell line, loaded at 0.2 mg/mL. Specific bands were detected for Paxillin at approximately 70 & 69 kDa (as indicated) using 50 µg/mL of Sheep Anti-Human/Mouse/Rat Paxillin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4259). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western blot shows lysates of MDA‑MB‑468 human breast cancer cell line and HepG2 human hepatocellular carcinoma cell line untreated (-) or treated (+) with 50 μM pervanadate (PV) for 10 minutes. PVDF membrane was probed with 1 µg/mL of Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Src (Y419) at approximately 56 - 61 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Src phosphorylated at Y419 was detected in immersion fixed paraffin-embedded sections of human liver cancer tissue using Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rabbit HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS005) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Src phosphorylated at Y419 was detected in immersion fixed paraffin-embedded sections of human liver array using Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rabbit HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS005) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(5 Publications)
Species: Hu
Applications: WB, Simple Western, IHC
p53 Antibody (PAb
240)
NB200-103
Western Blot: p53 Antibody (PAb 240) [NB200-103] - WB analysis of p53 in MCF7 and HeLa lystates. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: p53 Antibody (PAb 240) [NB200-103] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-p53 (PAb 240) [NB200-103] at a 1:200 dilution overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: p53 Antibody (PAb 240) [NB200-103] - p53 was detected in immersion fixed paraffin-embedded sections of human prostate cancer using anti-human mouse monoclonal antibody (Catalog # NB200-103) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue).Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
(2 Reviews)
(22 Publications)
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
p19ARF Antibody
NB200-106
Western Blot: p19ARF Antibody [NB200-106] - WB analysis of p19ARF in 1. NIH/3T3 and B. MEF cell lysate.
Immunocytochemistry/Immunofluorescence: p19ARF Antibody [NB200-106] - p19ARF antibody was tested in MEF cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
Immunohistochemistry-Paraffin: p19ARF Antibody [NB200-106] - IHC analysis of formalin fixed paraffin-embedded (FFPE) mouse spleen using p19ARF antibody at 10 ug/ml on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) using 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching with peroxide block. The sections were incubated with primary antibody for 30 minutes and Bond Polymer Refine Detection (Leica Biosystems) with DAB was used for signal development followed by counterstaining with hematoxylin. Whole slide scanning and capturing of representative images was performed using Aperio AT2 (Leica Biosystems). Nuclear staining in the germinal centers of spleen was observed. Staining was performed by Histowiz.
(40 Publications)
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
p27/Kip1 [p
Thr157] Antibody
AF1555
Western blot shows lysates of MCF-7 human breast cancer cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF-I (Catalog # 291‑G1) for 20 minutes. PVDF membrane was probed with 0.5 µg/mL Human Phospho-p27/Kip1 (T157) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1555) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band for Phospho-p27/Kip1 (T157) was detected at approximately 27 kDa (as indicated). The phospho-specificity of this antibody was supported by decreased labeling following treatment with 600 U lambda -phosphatase ( lambda -PPase) for 1 hour. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
(11 Publications)
Species: Hu
Applications: WB
TCEAL1 Antibody
(OTI2G10)
NBP2-46085
Western Blot: TCEAL1 Antibody (2G10) [NBP2-46085] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY TCEAL1.
Immunohistochemistry: TCEAL1 Antibody (2G10) [NBP2-46085] - Analysis of Human lymphoma tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)(
Immunohistochemistry: TCEAL1 Antibody (2G10) [NBP2-46085] - Analysis of Human Ovary tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)
Species: Hu
Applications: WB, IHC
D4S234E Antibody
(1C3)
H00027065-M01
Western Blot: D4S234E Antibody (1C3) [H00027065-M01] - D4S234E monoclonal antibody (M01), clone 1C3 Analysis of D4S234E expression in IMR-32.
Western Blot: D4S234E Antibody (1C3) [H00027065-M01] - D4S234E monoclonal antibody (M01), clone 1C3. Analysis of D4S234E expression in PC-12.
Western Blot: D4S234E Antibody (1C3) [H00027065-M01] - D4S234E monoclonal antibody (M01), clone 1C3. Analysis of D4S234E expression in rat brain.
(1 Publication)
Species: Hu, Rt
Applications: WB, ELISA
NOLC1 Antibody
NBP1-58200
NOLC1 Antibody
Species: Hu, Ze
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NOLC1 Antibody (NBP1-58200) (0)

There are no publications for NOLC1 Antibody (NBP1-58200).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NOLC1 Antibody (NBP1-58200) (0)

There are no reviews for NOLC1 Antibody (NBP1-58200). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NOLC1 Antibody (NBP1-58200) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NOLC1 Products

Bioinformatics Tool for NOLC1 Antibody (NBP1-58200)

Discover related pathways, diseases and genes to NOLC1 Antibody (NBP1-58200). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NOLC1 Antibody (NBP1-58200)

Discover more about diseases related to NOLC1 Antibody (NBP1-58200).
 

Pathways for NOLC1 Antibody (NBP1-58200)

View related products by pathway.

PTMs for NOLC1 Antibody (NBP1-58200)

Learn more about PTMs related to NOLC1 Antibody (NBP1-58200).
 

Research Areas for NOLC1 Antibody (NBP1-58200)

Find related products by research area.

Blogs on NOLC1

There are no specific blogs for NOLC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NOLC1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol NOLC1
Uniprot