NOLC1 Antibody

Western Blot: NOLC1 Antibody [NBP1-58200] - NOLC1 antibody - C-terminal region validated by WB using HepG2 cell lysate at 2.5ug/ml.

Immunocytochemistry/Immunofluorescence: NOLC1 Antibody [NBP1-58200] - Zebrafish kidney, 1:250 Image Submitted By: James Lister Virginia Commonwealth University

Immunohistochemistry-Paraffin: NOLC1 Antibody [NBP1-58200] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

• Reactivity: Hu, Ze
• Applications: WB, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

NOLC1 Antibody Summary

• Immunogen: Synthetic peptides corresponding to NOLC1(nucleolar and coiled-body phosphoprotein 1) The peptide sequence was selected from the C terminal of NOLC1. Peptide sequence DNSFDAKRGAAGDWGERANQVLKFTKGKSFRHEKTKKKRGSYRGGSISVQ.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NOLC1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence 1:10-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
• Application Notes: This is a rabbit polyclonal antibody against NOLC1 and was validated on Western Blot and immunohistochemistry-paraffin

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NOLC1 Antibody

• 140 kDa nucleolar phosphoprotein
• HCV NS5A trans-regulated protein 13
• HCV NS5A-transactivated protein 13
• Hepatitis C virus NS5A-transactivated protein 13
• KIAA0035NS5ATP13
• NOPP130
• NOPP140
• Nucleolar 130 kDa protein
• nucleolar and coiled-body phosphoprotein 1
• nucleolar and coiled-body phosphprotein 1
• Nucleolar phosphoprotein p130
• nucleolar protein p130
• P130

Background

Related to nucleologenesis, NOLC1 may play a role in the maintenance of the fundamental structure of the fibrillar center and dense fibrillar component in the nucleolus. It has intrinsic GTPase and ATPase activities. NOLC1 may play an important role in transcription catalyzed by RNA polymerase I.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NOLC1
• Uniprot:
  • Q14978(Human)