Recombinant Human Nogo GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Nogo GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-199 of Human RTN4 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MDGQKKNWKDKVVDLLYWRDIKKTGVVFGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKFAVLMWVFTYVGALFNGLTLLILALISLFSVPVIYERHQAQIDHYLGLANKNVKDAMAKIQAKIPGLKRKAE

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
RTN4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
47.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Nogo GST (N-Term) Protein

  • ASY
  • foocen
  • Human NogoA
  • KIAA0886
  • My043 protein
  • Nbla00271
  • Nbla10545
  • neurite growth inhibitor 220
  • Neurite outgrowth inhibitor
  • Neuroendocrine-specific protein C homolog
  • Neuroendocrine-specific protein
  • NI220/250
  • Nogo protein
  • NOGO-A
  • Nogo-B
  • NOGOC
  • Nogo-C
  • NOGORTN4-B1
  • NSP
  • NSP-CL
  • reticulon 4
  • reticulon 5
  • reticulon-4
  • reticulon-5
  • RTN4-A
  • RTN4-B2
  • RTN4-C
  • RTN-x

Background

RTN4( AAH01035, 1 a.a. - 200 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1440
Species: Mu
Applications: WB
538-MG
Species: Rt
Applications: BA
AF1674
Species: Mu
Applications: WB
H00004340-B01P
Species: Hu, Rt
Applications: WB
NBP1-32870
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
NBP1-88871
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-01264
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-13943
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-97677
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-84957
Species: Hu
Applications: IHC, IHC-P, WB
H00000518-P01
Species: Hu
Applications: ELISA, AP, PA, WB
MAB4077
Species: Hu
Applications: IHC, WB
MAB367
Species: Ca, Hu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
MAB6967
Species: Hu
Applications: WB
DBD00
Species: Hu
Applications: ELISA
NB100-91273
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00001523-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
H00057142-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for Nogo Recombinant Protein (H00057142-P01) (0)

There are no publications for Nogo Recombinant Protein (H00057142-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nogo Recombinant Protein (H00057142-P01) (0)

There are no reviews for Nogo Recombinant Protein (H00057142-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Nogo Recombinant Protein (H00057142-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Nogo Products

Bioinformatics Tool for Nogo Recombinant Protein (H00057142-P01)

Discover related pathways, diseases and genes to Nogo Recombinant Protein (H00057142-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nogo Recombinant Protein (H00057142-P01)

Discover more about diseases related to Nogo Recombinant Protein (H00057142-P01).
 

Pathways for Nogo Recombinant Protein (H00057142-P01)

View related products by pathway.

PTMs for Nogo Recombinant Protein (H00057142-P01)

Learn more about PTMs related to Nogo Recombinant Protein (H00057142-P01).
 

Research Areas for Nogo Recombinant Protein (H00057142-P01)

Find related products by research area.

Blogs on Nogo.

Nogo: A Promising Target for New Gene Therapies
Nogo is a neurite outgrowth inhibitor protein that plays an important role during central nervous system (CNS) development as well as in endoplasmic reticulum signaling regulation. Studies using Nogo antibodies have revealed Nogo proteins regulate ...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Nogo GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RTN4