We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Nogo Recombinant Protein Antigen

Images

 
There are currently no images for Nogo Protein (NBP2-47354PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Nogo Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RTN4.

Source: E. coli

Amino Acid Sequence: ETEAPYISIACDLIKETKLSAEPAPDFSDYSEMAKVEQPVPDHSELVEDSSPDSEPVDLFSDDSIPDVPQKQDETVMLVKESLTETSFESMIEYENKEKLSALPPEGGKPYLESFKLSLDNTKDTLLPDEVSTLS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RTN4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-47354.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Nogo Recombinant Protein Antigen

  • ASY
  • foocen
  • Human NogoA
  • KIAA0886
  • My043 protein
  • Nbla00271
  • Nbla10545
  • neurite growth inhibitor 220
  • Neurite outgrowth inhibitor
  • Neuroendocrine-specific protein C homolog
  • Neuroendocrine-specific protein
  • NI220/250
  • Nogo protein
  • NOGO-A
  • Nogo-B
  • NOGOC
  • Nogo-C
  • NOGORTN4-B1
  • NSP
  • NSP-CL
  • reticulon 4
  • reticulon 5
  • reticulon-4
  • reticulon-5
  • RTN4-A
  • RTN4-B2
  • RTN4-C
  • RTN-x

Background

Neurite Outgrowth Inhibitor (NOGO) is a myelin associated neurite growth inhibitor found in oligodendrocyte and central nervous system (CNS) myelin membranes of the adult CNS. NOGO plays a role in blocking axonal regeneration in the CNS of higher vertebrates. At least 6 isoforms have been observed arising from alternative splicing. NOGO-A (Isoform 1) is specifically expressed in brain and testes and weakly expressed in heart and skeletal muscle.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

538-MG
Species: Rt
Applications: BA
AF1674
Species: Mu
Applications: WB
AF2439
Species: Mu
Applications: IHC, WB
NBP1-32870
Species: Ch, Hu
Applications: IHC,  IHC-P, IP, KD, WB
NBP1-88871
Species: Hu
Applications: ICC/IF,  IHC-P
NBP2-01264
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-13943
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-97677
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-84957
Species: Hu
Applications: IHC,  IHC-P, WB
H00000518-P01
Species: Hu
Applications: ELISA, AP, PA, WB
MAB4077
Species: Hu
Applications: IHC, WB
AF1157
Species: Mu
Applications: IHC, WB
NBP1-85010
Species: Hu
Applications: IHC,  IHC-P
DBD00
Species: Hu
Applications: ELISA
NB100-91273
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00001523-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-47354PEP
Species: Hu
Applications: AC

Publications for Nogo Protein (NBP2-47354PEP) (0)

There are no publications for Nogo Protein (NBP2-47354PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nogo Protein (NBP2-47354PEP) (0)

There are no reviews for Nogo Protein (NBP2-47354PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Nogo Protein (NBP2-47354PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Nogo Products

Research Areas for Nogo Protein (NBP2-47354PEP)

Find related products by research area.

Blogs on Nogo.

Nogo: A Promising Target for New Gene Therapies
Nogo is a neurite outgrowth inhibitor protein that plays an important role during central nervous system (CNS) development as well as in endoplasmic reticulum signaling regulation. Studies using Nogo antibodies have revealed Nogo proteins regulate ...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Nogo Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RTN4