Nociceptin Antibody - BSA Free

Immunohistochemistry-Paraffin: Nociceptin Antibody [NBP2-58314] - Staining in human cerebral cortex and colon tissues using anti-PNOC antibody. Corresponding PNOC RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Nociceptin Antibody [NBP2-58314] - Staining of human cerebral cortex, colon, liver and testis using Anti-PNOC anibody NBP2-58314 (A0 shows similar protein distribution tissues o independent antibody.

Immunohistochemistry-Paraffin: Nociceptin Antibody [NBP2-58314] - Staining of human cerebral cortex shows high expression.

Immunohistochemistry-Paraffin: Nociceptin Antibody [NBP2-58314] - Staining of human colon shows low expression as expected.

Immunohistochemistry-Paraffin: Nociceptin Antibody [NBP2-58314] - Staining of human testis.

Immunohistochemistry-Paraffin: Nociceptin Antibody [NBP2-58314] - Staining of human liver.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Nociceptin Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RVRSLFQEQEEPEPGMEEAGEMEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQYLVLSMQSSQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PNOC
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Nociceptin Recombinant Protein Antigen (NBP2-58314PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Nociceptin Antibody - BSA Free

• nociceptin
• nocistatin
• OFQ
• P
• PPNOC
• prepronociceptin
• propronociceptin

Background

Nociceptin (Orphanin FQ, OFQ), a heptadecapeptide peptide, has been designated as an endogenous ligand for the ORL1 receptor. The amino acid sequence of nociceptin hashomology with other opioid peptides, especially the prodynorphin fragment dynorphin A, suggesting a close evolutionary relationship between the precursors. A diffuse distribution throughout the brain is seen with binding studies and in situ hybridization suggesting an extensive role for nociceptin in a multitude of CNS functions. Immunocytochemical localizations in rat spinal cord have demonstrated nociceptin abundance in superficial dorsal horn, lateral spinal nucleus and the region dorsal to the central canal. Nociceptin immunoreactivity was not affected by dorsal rhizotomy, indicating that in spinal cord the peptide is produced by central rather than primary afferent neurons. The localization is supported by its function in processing of nociceptive signals.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PNOC