Nociceptin Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: Nociceptin Antibody [NBP2-58314] - Staining in human cerebral cortex and colon tissues using anti-PNOC antibody. Corresponding PNOC RNA-seq data are presented ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: Nociceptin Antibody [NBP2-58314] - Staining of human cerebral cortex, colon, liver and testis using Anti-PNOC anibody NBP2-58314 (A0 shows similar protein ...read more
Immunohistochemistry-Paraffin: Nociceptin Antibody [NBP2-58314] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: Nociceptin Antibody [NBP2-58314] - Staining of human colon shows low expression as expected.
Immunohistochemistry-Paraffin: Nociceptin Antibody [NBP2-58314] - Staining of human testis.
Immunohistochemistry-Paraffin: Nociceptin Antibody [NBP2-58314] - Staining of human liver.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Nociceptin Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RVRSLFQEQEEPEPGMEEAGEMEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQYLVLSMQSSQ
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PNOC
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Nociceptin Recombinant Protein Antigen (NBP2-58314PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Nociceptin Antibody

  • nociceptin
  • nocistatin
  • OFQ
  • P
  • PPNOC
  • prepronociceptin
  • propronociceptin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-69143
Species: Hu
Applications: WB
NBP2-19561
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-46290
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NB200-541
Species: Mu
Applications: IA, ICC/IF, IHC, IHC-Fr, IP, WB
H00001392-M02
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NB600-101
Species: Bv, Ha, Hu, Mu, Pm, Rt
Applications: B/N, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, KD, PA, Simple Western, WB
MAB5826
Species: Hu
Applications: IHC, WB
MAB5285
Species: Hu
Applications: Simple Western, WB
NBP1-82558
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-31180
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-37856
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-58314
Species: Hu
Applications: IHC, IHC-P

Publications for Nociceptin Antibody (NBP2-58314) (0)

There are no publications for Nociceptin Antibody (NBP2-58314).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nociceptin Antibody (NBP2-58314) (0)

There are no reviews for Nociceptin Antibody (NBP2-58314). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Nociceptin Antibody (NBP2-58314) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Nociceptin Products

Bioinformatics Tool for Nociceptin Antibody (NBP2-58314)

Discover related pathways, diseases and genes to Nociceptin Antibody (NBP2-58314). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nociceptin Antibody (NBP2-58314)

Discover more about diseases related to Nociceptin Antibody (NBP2-58314).
 

Pathways for Nociceptin Antibody (NBP2-58314)

View related products by pathway.

Research Areas for Nociceptin Antibody (NBP2-58314)

Find related products by research area.

Blogs on Nociceptin

There are no specific blogs for Nociceptin, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Nociceptin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PNOC