NOC2L Recombinant Protein Antigen

Images

 
There are currently no images for NOC2L Recombinant Protein Antigen (NBP2-56871PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

NOC2L Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NOC2L.

Source: E.coli

Amino Acid Sequence: LLGKVQENSAYICSRRQRVSFGVSEQQAVEAWEKLTREEGTPLTLYYSHWRKLRDREIQLEISGKERLEDLNFPEIKRRKMADRKDEDRKQFKDLFDLNSS

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NOC2L
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-56871 The protein was purified by IMAC chromatography and the expected concentration is greater than 0.5 mg/ml. This protein is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related information and a protocol, click here.
Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for NOC2L Recombinant Protein Antigen

  • DKFZP564C186
  • FLJ35172
  • NET15
  • NET7
  • NIR
  • NOC2-like protein
  • novel INHAT (inhibitor of histone acetyltransferase) repressor
  • nucleolar complex associated 2 homolog (S. cerevisiae)
  • nucleolar complex protein 2 homolog
  • Protein NOC2 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1034
Species: Mu, Rt
Applications: WB, Simple Western, IHC
AF2340
Species: Hu
Applications: WB, Flow, IP, CyTOF-ready
AF3749
Species: Hu
Applications: WB, IHC
NB100-1481
Species: Hu
Applications: WB, PEP-ELISA
NB300-560
Species: Hu, Mu, Rt, Av, Bv, Ma, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85540
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-85297
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-93726
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-56244
Species: Hu
Applications: WB, ICC/IF
NBP1-31661
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB7330
Species: Hu
Applications: CyTOF-ready, ICFlow
NBP2-21792
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
AF1195
Species: Hu
Applications: WB, ELISA, IHC, Neut
NBP2-67599
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-56871PEP
Species: Hu
Applications: AC

Publications for NOC2L Recombinant Protein Antigen (NBP2-56871PEP) (0)

There are no publications for NOC2L Recombinant Protein Antigen (NBP2-56871PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NOC2L Recombinant Protein Antigen (NBP2-56871PEP) (0)

There are no reviews for NOC2L Recombinant Protein Antigen (NBP2-56871PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NOC2L Recombinant Protein Antigen (NBP2-56871PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional NOC2L Products

Bioinformatics Tool for NOC2L Recombinant Protein Antigen (NBP2-56871PEP)

Discover related pathways, diseases and genes to NOC2L Recombinant Protein Antigen (NBP2-56871PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NOC2L Recombinant Protein Antigen (NBP2-56871PEP)

Discover more about diseases related to NOC2L Recombinant Protein Antigen (NBP2-56871PEP).
 

Pathways for NOC2L Recombinant Protein Antigen (NBP2-56871PEP)

View related products by pathway.

PTMs for NOC2L Recombinant Protein Antigen (NBP2-56871PEP)

Learn more about PTMs related to NOC2L Recombinant Protein Antigen (NBP2-56871PEP).

Blogs on NOC2L

There are no specific blogs for NOC2L, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NOC2L Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NOC2L