NKX2.3 Antibody - BSA Free

Immunohistochemistry-Paraffin: NKX2.3 Antibody [NBP3-10406] - Immunohistochemical analysis of paraffin-embedded mouse lymphoid tissue (skeletal muscle) tissue. Antibody dilution of 5 ug/ml.

• Reactivity: Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

NKX2.3 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the c terminal region of mouse NKX2.3 (NP_032725). Peptide sequence AAAYSGSYGCAYPTGGGGGGGGTASAATTAMQPACSATGGGSFVNVSNLG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NKX2-3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
• Theoretical MW: 38 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for NKX2.3 Antibody - BSA Free

• CSX3NK2.3
• Homeobox protein NK-2 homolog C
• homeobox protein Nkx-2.3
• NK2 transcription factor related, locus 3 (Drosophila)
• NKX2.3
• NKX23
• NKX2CNK-2 (Drosophila) homolog C
• NKX4-3

Background

NKX2C is a member of the NKX family of homeodomain-containing transcription factors, which are implicated in many aspects of cell type specification and maintenance of differentiated tissue functions. See Harvey (1996) [PubMed 8812123] for a review of the structure, regulation, function, and evolution of NK2 homeobox genes with an emphasis on their roles in heart development.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NKX2-3