NKIRAS1 Antibody (2A7)

Images

 
Immunohistochemistry-Paraffin: NKIRAS1 Antibody (2A7) [H00028512-M01] - Analysis of monoclonal antibody to NKIRAS1 on formalin-fixed paraffin-embedded human prostate. Antibody concentration 1 ug/ml.
Sandwich ELISA: NKIRAS1 Antibody (2A7) [H00028512-M01] - Detection limit for recombinant GST tagged NKIRAS1 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC, IHC-P
Clone
2A7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NKIRAS1 Antibody (2A7) Summary

Immunogen
NKIRAS1 (AAH12145, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag.MGKGCKVVVCGLLSVGKTAILEQLLYGNHTIGMEDCETMEDV YMASVETDRGVKEQLHLYDTRGLQEGVELPKHYFSFADGFVL VYSVNNLESFQRVELL
Localization
Cytoplasmic
Specificity
NKIRAS1 - NFKB inhibitor interacting Ras-like 1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NKIRAS1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactive against recombinant protein for western blot. It has also been used for ELISA and immunohistochemistry (paraffin).

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NKIRAS1 Antibody (2A7)

  • I-kappa-B-interacting Ras-like protein 1
  • kappa B-ras 1
  • Kappa B-Ras protein 1
  • KappaB-Ras1
  • KBRAS1kappaB-Ras1
  • NF-kappa-B inhibitor-interacting Ras-like protein 1
  • NFKB inhibitor interacting Ras-like 1
  • NFKB inhibitor interacting Ras-like protein 1

Background

NF-kB is silenced in the cytoplasm by an inhibitory protein, IkB. Synthesis of IkBa is autoregulated. IkB proteins are phosphorylated by IkB kinase complex consisting of at least three proteins, IKK1/a, IKK2/b, and IKK3/g. External stimuli such as tumor necrosis factor or other cytokines results in phosphorylation and degradation of IkB releasing NF-kB dimers. NF-kB dimer subsequently translocates to the nucleus and activates target genes. Six members of IkB family members have been identified. One of the first genes induced following NF-kB activation is IkBa. Recently, two proteins, kB-Ras1 and kB-Ras2 have been identified. These two proteins interact with PEST domains of IkBa and IkBb and decrease their rate of degradation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-31913
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00028511-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB100-65125
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NBP2-16521
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
1670-SE
Species: Ec
AF3827
Species: Mu
Applications: WB, Flow, CyTOF-ready
NBP2-20212
Species: Hu
Applications: WB, IHC, IHC-P
MAB3425
Species: Hu, Rt
Applications: WB
NB100-56507
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-84528
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF3235
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-81480
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-29990
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB7635
Species: Hu
Applications: WB
H00084107-M09
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00028512-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P

Publications for NKIRAS1 Antibody (H00028512-M01) (0)

There are no publications for NKIRAS1 Antibody (H00028512-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NKIRAS1 Antibody (H00028512-M01) (0)

There are no reviews for NKIRAS1 Antibody (H00028512-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NKIRAS1 Antibody (H00028512-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NKIRAS1 Products

Bioinformatics Tool for NKIRAS1 Antibody (H00028512-M01)

Discover related pathways, diseases and genes to NKIRAS1 Antibody (H00028512-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NKIRAS1 Antibody (H00028512-M01)

Discover more about diseases related to NKIRAS1 Antibody (H00028512-M01).
 

Pathways for NKIRAS1 Antibody (H00028512-M01)

View related products by pathway.

PTMs for NKIRAS1 Antibody (H00028512-M01)

Learn more about PTMs related to NKIRAS1 Antibody (H00028512-M01).
 

Research Areas for NKIRAS1 Antibody (H00028512-M01)

Find related products by research area.

Blogs on NKIRAS1

There are no specific blogs for NKIRAS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NKIRAS1 Antibody (2A7) and receive a gift card or discount.

Bioinformatics

Gene Symbol NKIRAS1
Entrez
OMIM
Uniprot