NKIRAS1 Antibody (2A7) Summary
| Immunogen |
NKIRAS1 (AAH12145, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag.MGKGCKVVVCGLLSVGKTAILEQLLYGNHTIGMEDCETMEDV
YMASVETDRGVKEQLHLYDTRGLQEGVELPKHYFSFADGFVL
VYSVNNLESFQRVELL |
| Localization |
Cytoplasmic |
| Specificity |
NKIRAS1 - NFKB inhibitor interacting Ras-like 1 |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
NKIRAS1 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Western Blot 1:500
|
| Application Notes |
Antibody reactive against recombinant protein for western blot. It has also been used for ELISA and immunohistochemistry (paraffin). |
Reactivity Notes
Human. Other species not tested.
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for NKIRAS1 Antibody (2A7)
Background
NF-kB is silenced in the cytoplasm by an inhibitory protein, IkB. Synthesis of IkBa is autoregulated. IkB proteins are phosphorylated by IkB kinase complex consisting of at least three proteins, IKK1/a, IKK2/b, and IKK3/g. External stimuli such as tumor necrosis factor or other cytokines results in phosphorylation and degradation of IkB releasing NF-kB dimers. NF-kB dimer subsequently translocates to the nucleus and activates target genes. Six members of IkB family members have been identified. One of the first genes induced following NF-kB activation is IkBa. Recently, two proteins, kB-Ras1 and kB-Ras2 have been identified. These two proteins interact with PEST domains of IkBa and IkBb and decrease their rate of degradation.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt, Sq, Xp
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Rt
Applications: Bind
Species: Ec
Applications: EnzAct
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: WB, ELISA, IHC
Publications for NKIRAS1 Antibody (H00028512-M01) (0)
There are no publications for NKIRAS1 Antibody (H00028512-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for NKIRAS1 Antibody (H00028512-M01) (0)
There are no reviews for NKIRAS1 Antibody (H00028512-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for NKIRAS1 Antibody (H00028512-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional NKIRAS1 Products
Research Areas for NKIRAS1 Antibody (H00028512-M01)
Find related products by research area.
|
Blogs on NKIRAS1