Recombinant Human NKCC2/SLC12A1 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human NKCC2/SLC12A1 Protein [H00006557-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human NKCC2/SLC12A1 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-430 of Human SLC12A1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MSLNNSSNVFLDSVPSNTNRFQVSVINENHESSAAADDNTDPPHYEETSFGDEAQKRLRISFRPGNQECYDNFLQSGETAKTDASFHAYDSHTNTYYLQTFGHNTMDAVPKIEYYRNTGSISGPKVNRPSLLEIHEQLAKNVAVTPSSADRVANGDGIPGDEQAENKEDDQAGVVKFGWVKGVLVRCMLNIWGVMLFIRLSWIVGEAGIGLGVLIILLSTMVTSITGLSTSAIATNGFVRGGGAYYLISRSLGPEFGGSIGLIFAFANAVAVAMYVVGFAETVVDLLKESDSMMVDPTNDIRIIGSITVVILLGISVAGMEWEAKAQVILLVILLIAIANFFIGTVIPSNNEKKSRGFFNYQASIFAENFGPRFTKGEGFFSVFAIFFPAATGILAGANISGDLEALRKQGASPLPQGAQSRRRRQTSLI

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
SLC12A1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
72.9 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NKCC2/SLC12A1 GST (N-Term) Protein

  • BSC1
  • Bumetanide-sensitive sodium-(potassium)-chloride cotransporter 2
  • Kidney-specific Na-K-Cl symporter
  • MGC48843
  • NKCC2
  • NKCC2A variant A
  • NKCC2Na-K-2Cl cotransporter
  • SLC12A1
  • solute carrier family 12 (sodium/potassium/chloride transporters), member 1
  • solute carrier family 12 member 1

Background

The sodium-potassium-chloride cotransporter isoform 2 is kidney-specific and is found on the apical membrane of the thick ascending limb of Henle's loop and the macula densa. It accounts for most of the NaCl resorption with the stoichiometry of 1Na:1K:2Cl and is sensitive to such diuretics as furosemide and bumetanide. Some Bartter-like syndromes result from defects in this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-44270
Species: Mu, Rt
Applications: EM, ICC/IF, IHC, IHC-P, WB
NB100-75623
Species: Bv, Ca, Hu, Mu, Pm, Rt
Applications: IHC, WB
NBP1-82874
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NB110-74682
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB110-81529
Species: Hu, Mu, Ma-Op, Po, Pm, Rb, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IP, KD, KO, Simple Western, WB
NBP1-82016
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00001188-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-48021
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF4090
Species: Hu
Applications: IHC, IP, Neut, WB
NB600-749
Species: Hu, Mu, Rb, Rt, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
AF009
Species: Hu
Applications: IHC, WB
NB100-56598
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P, KD, WB
NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB5175
Species: Mu
Applications: IHC, WB
NBP2-49101
Species: Hu
Applications: IHC, IHC-P
H00009943-M16
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
H00006557-P01
Species: Hu
Applications: WB, ELISA, PA, PAGE, AP

Publications for NKCC2/SLC12A1 Recombinant Protein (H00006557-P01) (0)

There are no publications for NKCC2/SLC12A1 Recombinant Protein (H00006557-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NKCC2/SLC12A1 Recombinant Protein (H00006557-P01) (0)

There are no reviews for NKCC2/SLC12A1 Recombinant Protein (H00006557-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NKCC2/SLC12A1 Recombinant Protein (H00006557-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NKCC2/SLC12A1 Products

Bioinformatics Tool for NKCC2/SLC12A1 Recombinant Protein (H00006557-P01)

Discover related pathways, diseases and genes to NKCC2/SLC12A1 Recombinant Protein (H00006557-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NKCC2/SLC12A1 Recombinant Protein (H00006557-P01)

Discover more about diseases related to NKCC2/SLC12A1 Recombinant Protein (H00006557-P01).
 

Pathways for NKCC2/SLC12A1 Recombinant Protein (H00006557-P01)

View related products by pathway.

PTMs for NKCC2/SLC12A1 Recombinant Protein (H00006557-P01)

Learn more about PTMs related to NKCC2/SLC12A1 Recombinant Protein (H00006557-P01).
 

Research Areas for NKCC2/SLC12A1 Recombinant Protein (H00006557-P01)

Find related products by research area.

Blogs on NKCC2/SLC12A1

There are no specific blogs for NKCC2/SLC12A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NKCC2/SLC12A1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC12A1