Recombinant Human NKAIN2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human NKAIN2 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 207 of Human NKAIN2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MGIIRFLLLYCPTNILTVCVLERQIFDFLGYQWAPILANFVHIIIVILGLFGTIQYRPRYITGYAVWLVLWVTWNVFVICFYLEAGDLSKETDLILTFNISMHRSWWMENGPGCTVTSVTPAPDWAPEDHRYITVSGCLLEYQYIEVAHSSLQIVLALAGFIYACYVVKCITEEEDSFDFIGGFDSYGYQGPQKTSHLQLQPMYMSK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
NKAIN2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NKAIN2 Protein

  • FAM77BMGC41924
  • Na(+)/K(+)-transporting ATPase subunit beta-1-interacting protein 2
  • Na+/K+ transporting ATPase interacting 2
  • NKAIP2
  • Protein FAM77B
  • sodium/potassium-transporting ATPase subunit beta-1-interacting protein 2
  • TCBA
  • TCBA1
  • T-cell lymphoma breakpoint associated target 1
  • T-cell lymphoma breakpoint-associated target protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00026054-M01
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP2-01752
Species: Hu
Applications: WB, IHC, IHC-P
NB600-1522
Species: Hu, Mu
Applications: WB, GS, ICC/IF
NBP1-81743
Species: Hu
Applications: WB, IHC, IHC-P
AF756
Species: Mu
Applications: WB, IHC
MAB2476
Species: Hu
Applications: WB, IHC
AF4496
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NB100-56082
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP1-90202
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88871
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF7117
Species: Hu, Mu
Applications: WB, IHC, ICC
NB100-65678
Species: Hu, Mu, Rt, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-15278
Species: Hu
Applications: WB, IHC, IHC-P
AF3315
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-127
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-85156
Species: Hu
Applications: WB, IHC, IHC-P

Publications for NKAIN2 Recombinant Protein (H00154215-P01) (0)

There are no publications for NKAIN2 Recombinant Protein (H00154215-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NKAIN2 Recombinant Protein (H00154215-P01) (0)

There are no reviews for NKAIN2 Recombinant Protein (H00154215-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NKAIN2 Recombinant Protein (H00154215-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NKAIN2 Products

NKAIN2 H00154215-P01

Bioinformatics Tool for NKAIN2 Recombinant Protein (H00154215-P01)

Discover related pathways, diseases and genes to NKAIN2 Recombinant Protein (H00154215-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NKAIN2 Recombinant Protein (H00154215-P01)

Discover more about diseases related to NKAIN2 Recombinant Protein (H00154215-P01).
 

Pathways for NKAIN2 Recombinant Protein (H00154215-P01)

View related products by pathway.

Blogs on NKAIN2

There are no specific blogs for NKAIN2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NKAIN2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NKAIN2