Recombinant Human NKAIN2 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human NKAIN2 GST (N-Term) Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 207 of Human NKAIN2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MGIIRFLLLYCPTNILTVCVLERQIFDFLGYQWAPILANFVHIIIVILGLFGTIQYRPRYITGYAVWLVLWVTWNVFVICFYLEAGDLSKETDLILTFNISMHRSWWMENGPGCTVTSVTPAPDWAPEDHRYITVSGCLLEYQYIEVAHSSLQIVLALAGFIYACYVVKCITEEEDSFDFIGGFDSYGYQGPQKTSHLQLQPMYMSK

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
NKAIN2
Purity
>10% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
50.2 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>10% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NKAIN2 GST (N-Term) Protein

  • FAM77BMGC41924
  • Na(+)/K(+)-transporting ATPase subunit beta-1-interacting protein 2
  • Na+/K+ transporting ATPase interacting 2
  • NKAIP2
  • Protein FAM77B
  • sodium/potassium-transporting ATPase subunit beta-1-interacting protein 2
  • TCBA
  • TCBA1
  • T-cell lymphoma breakpoint associated target 1
  • T-cell lymphoma breakpoint-associated target protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00026054-M01
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, S-ELISA
NBP2-01752
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-55709
Species: Hu
Applications: WB, ICC/IF
NBP2-81990
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF756
Species: Mu
Applications: WB, IHC
MAB2476
Species: Hu
Applications: WB, IHC
NLS54
Species: Hu, Mu, Ca
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NB100-56082
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
H00054998-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-88871
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF7117
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-90201
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-15278
Species: Hu
Applications: WB, IHC, IHC-P
AF3315
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-127
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-75472
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NKAIN2 Recombinant Protein (H00154215-P01) (0)

There are no publications for NKAIN2 Recombinant Protein (H00154215-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NKAIN2 Recombinant Protein (H00154215-P01) (0)

There are no reviews for NKAIN2 Recombinant Protein (H00154215-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NKAIN2 Recombinant Protein (H00154215-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional NKAIN2 Products

Array H00154215-P01

Bioinformatics Tool for NKAIN2 Recombinant Protein (H00154215-P01)

Discover related pathways, diseases and genes to NKAIN2 Recombinant Protein (H00154215-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NKAIN2 Recombinant Protein (H00154215-P01)

Discover more about diseases related to NKAIN2 Recombinant Protein (H00154215-P01).
 

Pathways for NKAIN2 Recombinant Protein (H00154215-P01)

View related products by pathway.

Blogs on NKAIN2

There are no specific blogs for NKAIN2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Alix Antibody
NBP1-90201
SENP6 Antibody (4B7)
H00026054-M01

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NKAIN2 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NKAIN2