NIPAL4 Recombinant Protein Antigen

Images

 
There are currently no images for NIPAL4 Protein (NBP1-93678PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

NIPAL4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NIPAL4.

Source: E.coli

Amino Acid Sequence: FKDLDISCASLPHMHKNPPPSPAPEPTVIRLEDKNVLVDNIELASTSSPEEKPKVFIIHS

Protein/Peptide Type
Recombinant Protein Antigen
Gene
NIPAL4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-93678.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related protocol, click here.
Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NIPAL4 Recombinant Protein Antigen

  • NIPA-like domain containing 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1844
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-89409
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-32533
Species: Hu
Applications: WB, IHC, IHC-P
NB100-93466
Species: Hu, Mu
Applications: ICC/IF, IP, PEP-ELISA
H00126410-B01P
Species: Hu
Applications: WB, ELISA
NBP2-29941
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-93476
Species: Hu
Applications: IHC, IHC-P
NBP1-87527
Species: Hu
Applications: IHC, IHC-P
NBP2-59320
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC
NB100-2527
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-16061
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF2940
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-89165
Species: Hu
Applications: IHC, IHC-P
NBP1-86461
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NBP1-93678PEP
Species: Hu
Applications: AC

Publications for NIPAL4 Protein (NBP1-93678PEP) (0)

There are no publications for NIPAL4 Protein (NBP1-93678PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NIPAL4 Protein (NBP1-93678PEP) (0)

There are no reviews for NIPAL4 Protein (NBP1-93678PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for NIPAL4 Protein (NBP1-93678PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NIPAL4 Products

Bioinformatics Tool for NIPAL4 Protein (NBP1-93678PEP)

Discover related pathways, diseases and genes to NIPAL4 Protein (NBP1-93678PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NIPAL4 Protein (NBP1-93678PEP)

Discover more about diseases related to NIPAL4 Protein (NBP1-93678PEP).
 

Pathways for NIPAL4 Protein (NBP1-93678PEP)

View related products by pathway.

Blogs on NIPAL4

There are no specific blogs for NIPAL4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

NIPAL4 Antibody
NBP1-93678
LOX Antibody
NB100-2527
LOX Antibody
NB100-2527
LOX Antibody
NB100-2527

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NIPAL4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NIPAL4