Novus Biologicals products are now on bio-techne.com

Recombinant Human NIPA GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human NIPA GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-212 of Human ZC3HC1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MTDLDASFGLTSSPIPGLEGRPERLPLVPESPRRMMTRSQDATFSPGSEQAEKSPGPIVSRTRSWDSSSPVDRPEPEAASPTTRTRPVTRSMGTGDTPGLEVPSSPLRKAKRARLCSSSSSDTSSRSFFDPTSQHRDWCPWVNITLGKESRENGGTEPDASAPAEPGWKAVLTILLAHKQSSQPAETDSMSLSEKSRKVFRIFRQWESLCSC

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
ZC3HC1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
49.6 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NIPA GST (N-Term) Protein

  • C3HC type 1
  • FBXO50
  • zinc finger, C3HC-type containing 1

Background

Entry into mitosis is essentially driven by cyclin B1, which is located in the cytoplasm throughout interphase, but accumulates in the nucleus just before mitosis occurs. Nuclear interaction partner of ALK (NIPA) plays a critical role in cyclin B1 regulation. NIPA is normally phosphorylated during G2 and M phases, resulting in an accumulation of cyclin B1. When NIPA sheds its attached phosphate, it binds to SCF to form the SCFNIPA complex, a member of the E3 ubiquitin ligases, which ubiquitinates cyclin B1, thereby targeting it to the proteosome for degradation. Therefore, the accumulation of cyclin B1 is due to the inability of phosphorylated NIPA to bind to the molecule SCF, thereby preventing the degradation of cyclin B1. An absence of NIPA causes cyclin B1 to accumulate abnormally, leading to premature mitotic entry, loss of checkpoint control and genomic instability, which are all associated with cancer. The phosphorylated form of NIPA may also be involved in apoptotic signaling pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6000
Species: Hu, Mu
Applications: IHC, Simple Western, WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89150
Species: Hu, Rt
Applications: IHC, IHC-P, WB
H00011026-M01
Species: Hu
Applications: ELISA, WB
255-SC
Species: Hu
Applications: BA
H00003126-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-20380
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-85729
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
7770-GT
Species: Hu
Applications: EnzAct
NBP2-93808
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-45312
Species: Hu, Pm, Mu(-)
Applications: Flow, ICC/IF, IF, IHC, IHC-P, WB
NBP2-15596
Species: Hu, Mu
Applications: ICC/IF, WB
NBP1-81748
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF347
Species: Hu
Applications: IHC, Neut, WB
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00143384-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP1-86509
Species: Hu
Applications: IHC, IHC-P
NBP2-15840
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
H00051530-P02
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for NIPA Recombinant Protein (H00051530-P02) (0)

There are no publications for NIPA Recombinant Protein (H00051530-P02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NIPA Recombinant Protein (H00051530-P02) (0)

There are no reviews for NIPA Recombinant Protein (H00051530-P02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NIPA Recombinant Protein (H00051530-P02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NIPA Products

Research Areas for NIPA Recombinant Protein (H00051530-P02)

Find related products by research area.

Blogs on NIPA

There are no specific blogs for NIPA, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NIPA GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ZC3HC1