Niemann-Pick type C2 Antibody

Western Blot: Niemann-Pick type C2 Antibody [H00010577-D01P] - Analysis of NPC2 expression in mouse lung.

Western Blot: Niemann-Pick type C2 Antibody [H00010577-D01P] - Analysis of NPC2 expression in PC-12.

Western Blot: Niemann-Pick type C2 Antibody [H00010577-D01P] - Analysis of NPC2 expression in human kidney.

Western Blot: Niemann-Pick type C2 Antibody [H00010577-D01P] - Analysis of NPC2 expression in transfected 293T cell line by NPC2 polyclonal antibody.Lane 1: NPC2 transfected lysate(16.60 KDa).Lane 2: Non-transfected lysate.

Product Discontinued

Niemann-Pick type C2 Antibody Summary

• Immunogen: NPC2 (NP_006423.1, 1 a.a. - 151 a.a.) full-length human protein. MRFLAATFLLLALSTAAQAEPVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQIVSHL
• Specificity: Reacts with Niemann-Pick disease, type C2.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NPC2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: This antibody is reactive against tissue and transfected lysate in western blot, and as a detection antibody in ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Niemann-Pick type C2 Antibody

• EDDM1
• Epididymal Protein 1
• epididymal secretory protein E1
• HE1
• HE1epididymal protein 1
• Human epididymis-specific protein 1
• MGC1333
• Niemann-Pick disease type C2 protein
• Niemann-Pick disease, type C2
• NiemannPick Type C2
• Niemann-Pick Type C2
• NPC2
• NP-C2
• tissue-specific secretory protein

Background

This gene encodes a protein containing a lipid recognition domain. The encoded protein may function in regulating the transport of cholesterol through the late endosomal/lysosomal system. Mutations in this gene have been associated with Niemann-Pick disease, type C2 and frontal lobe atrophy. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Niemann-Pick type C2 Antibody (H00010577-D01P)(1)

Publication using H00010577-D01P

• Marquer C, Tian H, Yi J et al. Arf6 controls retromer traffic and intracellular cholesterol distribution via a phosphoinositide-based mechanism. Nat Commun 2016-06-23 [PMID: 27336679] (WB)

FAQs for Niemann-Pick type C2 Antibody (H00010577-D01P). (Showing 1 - 1 of 1 FAQ).

1. I'm looking for a Niemann-Pick type1 or 2 antibody to stain mouse heart section embedded in paraffin. I would like to label these sections with another primary antibody to show colocalisation of my protein of interest. I would like to know if you have a rabbit anti-Niemann-Pick antibody that works well for fluorescence immunohistochemistry?
   • Niemann-Pick C1 Antibody (NB400-148) (0.1 ml) is one of our best sellers and this antibody has been cited in at least 17 peer reviewed research publications in journals of high repute. We have only one Niemann-Pick type C2 antibody with catalog # H00010577-D01PInnovators Reward Program.

Bioinformatics

• Gene Symbol: NPC2
• Entrez:
  • 10577(Human)
• Uniprot:
  • NP_006423.1(Human)