Nidogen-2 Antibody

Immunohistochemistry-Paraffin: Nidogen-2 Antibody [NBP2-49045] - Analysis in human placenta and duodenum tissues. Corresponding Nidogen-2 RNA-seq data are presented for the same tissues.

Western Blot: Nidogen-2 Antibody [NBP2-49045] - Analysis using Anti-NID2 antibody NBP2-49045 (A) shows similar pattern to independent antibody NBP2-55427 (B).

Immunocytochemistry/Immunofluorescence: Nidogen-2 Antibody [NBP2-49045] - Staining of human cell line BJ shows localization to plasma membrane.

Immunohistochemistry-Paraffin: Nidogen-2 Antibody [NBP2-49045] - Staining of human prostate shows moderate membranous positivity in smooth muscle cells.

Immunohistochemistry-Paraffin: Nidogen-2 Antibody [NBP2-49045] - Staining of human duodenum shows no positivity in glandular cells as expected.

Immunohistochemistry-Paraffin: Nidogen-2 Antibody [NBP2-49045] - Staining of human heart muscle shows strong membranous positivity in cardiomyocytes.

Immunohistochemistry: Nidogen-2 Antibody [NBP2-49045] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.

Product Discontinued

Nidogen-2 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: HTKEGTSLGEVGGPDLKGQVEPWDERETRSPAPPEVDRDSLAPSWETPPPYPENGSIQPYPDGGPVPSEMDVPPAHPEEEIVLRSYPASGHTT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NID2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Nidogen-2 Antibody

• NID2
• NID-2
• nidogen 2 (osteonidogen)
• Nidogen2
• Nidogen-2
• Osteonidogen

Background

Basement membranes, which are composed of type IV collagens (see MIM 120130), laminins (see LAMC1; MIM 150290), perlecan (HSPG2; MIM 142461), and nidogen (see NID1; MIM 131390), are thin pericellular protein matrices that control a large number of cellular activities, including adhesion, migration, differentiation, gene expression, and apoptosis.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NID2