Recombinant Human Nicotinic Acetylcholine Receptor beta 4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Nicotinic Acetylcholine Receptor beta 4 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-110 of Human CHRNB4 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:VNEREQIMTTNVWLKQEWTDYRLTWNSSRYEGVNILRIPAKRIWLPDIVLYNNADGTYEVSVYTNLIVRSNGSVLWLPPAIYKSACKIEVKYFPFDQQNCTLKFRSWTYD

Protein/Peptide Type
Partial Recombinant Protein
Gene
CHRNB4

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Nicotinic Acetylcholine Receptor beta 4 Protein

  • cholinergic receptor, nicotinic, beta 4
  • cholinergic receptor, nicotinic, beta polypeptide 4
  • neuronal acetylcholine receptor subunit beta-4
  • neuronal nicotinic receptor beta 4 subunit

Background

CHRNB4 - cholinergic receptor, nicotinic, beta polypeptide 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-69122
Species: Hu
Applications: WB
NBP1-87534
Species: Hu, Mu
Applications: IHC, IHC-P
NBP1-89333
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NBP1-28467
Species: Hu
Applications: WB, IHC-P, PEP-ELISA
NBP1-79948
Species: Hu, Rt
Applications: WB
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready
NBP1-80090
Species: Hu
Applications: WB
H00001142-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-1798
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P, GS
NBP2-01608
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC, IHC-P
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP1-30052
Species: Hu, Mu, Rt, Av, Ch, GP, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-WhMt
H00001143-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Nicotinic Acetylcholine Receptor beta 4 Partial Recombinant Protein (H00001143-Q01) (0)

There are no publications for Nicotinic Acetylcholine Receptor beta 4 Partial Recombinant Protein (H00001143-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nicotinic Acetylcholine Receptor beta 4 Partial Recombinant Protein (H00001143-Q01) (0)

There are no reviews for Nicotinic Acetylcholine Receptor beta 4 Partial Recombinant Protein (H00001143-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Nicotinic Acetylcholine Receptor beta 4 Partial Recombinant Protein (H00001143-Q01). (Showing 1 - 1 of 1 FAQ).

  1. I am looking to buy antibodies against most of the nicotinic receptor subunits for WB and IHC application. Could you please indicate which of your antibodies have been used by other researchers and provide publications showing their use? Thanks.
    • A list of our antibodies directed against he nicotinic acetylcholine receptors can be found here. Any products with publications will be indicated on the search page and can be found under the publications tab on the individual product's datasheet. Furthermore, we guarantee all of our products for the applications and species list on the datasheet. This should help narrow down your search.

Additional Nicotinic Acetylcholine Receptor beta 4 Products

Bioinformatics Tool for Nicotinic Acetylcholine Receptor beta 4 Partial Recombinant Protein (H00001143-Q01)

Discover related pathways, diseases and genes to Nicotinic Acetylcholine Receptor beta 4 Partial Recombinant Protein (H00001143-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nicotinic Acetylcholine Receptor beta 4 Partial Recombinant Protein (H00001143-Q01)

Discover more about diseases related to Nicotinic Acetylcholine Receptor beta 4 Partial Recombinant Protein (H00001143-Q01).
 

Pathways for Nicotinic Acetylcholine Receptor beta 4 Partial Recombinant Protein (H00001143-Q01)

View related products by pathway.

PTMs for Nicotinic Acetylcholine Receptor beta 4 Partial Recombinant Protein (H00001143-Q01)

Learn more about PTMs related to Nicotinic Acetylcholine Receptor beta 4 Partial Recombinant Protein (H00001143-Q01).

Blogs on Nicotinic Acetylcholine Receptor beta 4

There are no specific blogs for Nicotinic Acetylcholine Receptor beta 4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BDNF [Unconjugated]
248-BD-005/CF
IRP2 Antibody
NB100-1798

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Nicotinic Acetylcholine Receptor beta 4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CHRNB4