Recombinant Human Nicotinic Acetylcholine Receptor beta 2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Nicotinic Acetylcholine Receptor beta 2 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-105 of Human CHRNB2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:TDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISVHEREQIMTTNVWLTQEWEDYRLTWKPEEFDNMKKVRLPSKHIWLPDVVLYNNADGMYEVS

Protein/Peptide Type
Partial Recombinant Protein
Gene
CHRNB2

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Nicotinic Acetylcholine Receptor beta 2 Protein

  • cholinergic receptor, nicotinic, beta 2 (neuronal)
  • cholinergic receptor, nicotinic, beta polypeptide 2 (neuronal)
  • EFNL3
  • nAChRB2
  • neuronal acetylcholine receptor subunit beta-2
  • neuronal nicotinic acetylcholine receptor beta 2

Background

Neuronal acetylcholine receptors are homo- or heteropentameric complexes composed of homologous alpha and beta subunits. They belong to a superfamily of ligand-gated ion channels which allow the flow of sodium and potassium across the plasma membrane in response to ligands such as acetylcholine and nicotine. This gene encodes one of several beta subunits. Mutations in this gene are associated with autosomal dominant nocturnal frontal lobe epilepsy. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-69122
Species: Hu
Applications: WB
NBP1-80090
Species: Hu
Applications: WB
NBP1-79948
Species: Hu, Rt
Applications: WB
H00001142-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-87534
Species: Hu, Mu
Applications: IHC, IHC-P
NBP2-60788
Species: Mu, Rt
Applications: WB, ICC/IF
NBP2-58876
Species: Hu
Applications: ICC/IF
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP2-04663
Species: Hu
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NBP1-88645
Species: Hu
Applications: IHC, IHC-P
NBP1-74102
Species: Mu, ChHa
Applications: WB
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBL1-07321
Species: Hu

Publications for Nicotinic Acetylcholine Receptor beta 2 Partial Recombinant Protein (H00001141-Q01) (0)

There are no publications for Nicotinic Acetylcholine Receptor beta 2 Partial Recombinant Protein (H00001141-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nicotinic Acetylcholine Receptor beta 2 Partial Recombinant Protein (H00001141-Q01) (0)

There are no reviews for Nicotinic Acetylcholine Receptor beta 2 Partial Recombinant Protein (H00001141-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Nicotinic Acetylcholine Receptor beta 2 Partial Recombinant Protein (H00001141-Q01). (Showing 1 - 1 of 1 FAQ).

  1. I am looking to buy antibodies against most of the nicotinic receptor subunits for WB and IHC application. Could you please indicate which of your antibodies have been used by other researchers and provide publications showing their use? Thanks.
    • A list of our antibodies directed against he nicotinic acetylcholine receptors can be found here. Any products with publications will be indicated on the search page and can be found under the publications tab on the individual product's datasheet. Furthermore, we guarantee all of our products for the applications and species list on the datasheet. This should help narrow down your search.

Additional Nicotinic Acetylcholine Receptor beta 2 Products

Bioinformatics Tool for Nicotinic Acetylcholine Receptor beta 2 Partial Recombinant Protein (H00001141-Q01)

Discover related pathways, diseases and genes to Nicotinic Acetylcholine Receptor beta 2 Partial Recombinant Protein (H00001141-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nicotinic Acetylcholine Receptor beta 2 Partial Recombinant Protein (H00001141-Q01)

Discover more about diseases related to Nicotinic Acetylcholine Receptor beta 2 Partial Recombinant Protein (H00001141-Q01).
 

Pathways for Nicotinic Acetylcholine Receptor beta 2 Partial Recombinant Protein (H00001141-Q01)

View related products by pathway.

Blogs on Nicotinic Acetylcholine Receptor beta 2

There are no specific blogs for Nicotinic Acetylcholine Receptor beta 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BDNF [Unconjugated]
248-BD-005/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Nicotinic Acetylcholine Receptor beta 2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CHRNB2