Nicotinic Acetylcholine R alpha 9/CHRNA9 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human Nicotinic Acetylcholine R alpha 9/CHRNA9. Peptide sequence: NWSHSCISFCWIYFAASRLRAAETADGKYAQKLFNDLFEDYSNALRPVED The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CHRNA9 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for Nicotinic Acetylcholine R alpha 9/CHRNA9 Antibody - BSA Free
Background
CHRNA9 is a member of the ligand-gated ionic channel family and nicotinic acetylcholine receptor gene superfamily. It encodes a plasma membrane protein that forms homo- or hetero-oligomeric divalent cation channels. This protein is involved in cochlea hair cell development and is also expressed in the outer hair cells (OHCs) of the adult cochlea. The protein is additionally expressed in keratinocytes, the pituitary gland, B-cells and T-cells. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, WB
Species: Hu
Applications: ELISA, Flow, WB
Species: Hu, Pm
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Bv, Ca, Ch, Eq, Hu, Pm, Po
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Rt
Applications: ELISA, Flow, WB
Species: Hu, Mu
Applications: DB, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Rt
Applications: ELISA, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Ch, Gp, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, WB
Species: Hu
Applications: ChIP, ICC/IF
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
Species: Hu
Applications: WB
Publications for Nicotinic Acetylcholine R alpha 9/CHRNA9 Antibody (NBP2-84182) (0)
There are no publications for Nicotinic Acetylcholine R alpha 9/CHRNA9 Antibody (NBP2-84182).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Nicotinic Acetylcholine R alpha 9/CHRNA9 Antibody (NBP2-84182) (0)
There are no reviews for Nicotinic Acetylcholine R alpha 9/CHRNA9 Antibody (NBP2-84182).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Nicotinic Acetylcholine R alpha 9/CHRNA9 Antibody (NBP2-84182) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Nicotinic Acetylcholine R alpha 9/CHRNA9 Products
Research Areas for Nicotinic Acetylcholine R alpha 9/CHRNA9 Antibody (NBP2-84182)
Find related products by research area.
|
Blogs on Nicotinic Acetylcholine R alpha 9/CHRNA9