Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody (7D3)

Images

 
Western Blot: Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody (7D3) [H00001138-M01] - Analysis of CHRNA5 expression in transfected 293T cell line by CHRNA5 monoclonal antibody (M01), clone 7D3.Lane 1: CHRNA5 ...read more
Sandwich ELISA: Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody (7D3) [H00001138-M01] - Detection limit for recombinant GST tagged CHRNA5 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
7D3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody (7D3) Summary

Immunogen
CHRNA5 (NP_000736, 38 a.a. - 131 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SEPSSIAKHEDSLLKDLFQDYERWVRPVEHLNDKIKIKFGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKVIRVPSDSVWTP
Specificity
CHRNA5 - cholinergic receptor, nicotinic, alpha polypeptide 5
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CHRNA5
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody (7D3)

  • Cholinergic receptor, neuronal nicotinic, alpha polypeptide-5
  • cholinergic receptor, nicotinic, alpha 5
  • cholinergic receptor, nicotinic, alpha polypeptide 5
  • CHRNA5
  • LNCR2
  • NACHRA5
  • neuronal acetylcholine receptor subunit alpha-5
  • neuronal nicotinic acetylcholine receptor, alpha5 subunit
  • Nicotinic Acetylcholine R alpha 5
  • Nicotinic Acetylcholine Ra5

Background

Nicotinic acetylcholine receptors (nAChRs), such as CHRNA5, are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The nAChRs are thought to be (hetero)pentamers composed of homologous subunits. See MIM 118508 for additional background information on AChRs.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87534
Species: Hu, Mu
Applications: IHC, IHC-P
NBP2-60788
Species: Mu, Rt
Applications: WB, ICC/IF
NBP1-28467
Species: Hu
Applications: WB, IHC-P, PEP-ELISA
NBP1-85487
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00001142-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-01437
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, IHC, IHC-P
NBP1-89333
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB100-1798
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P, GS
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NBP1-79948
Species: Hu, Rt
Applications: WB
NBP1-80090
Species: Hu
Applications: WB
AF3014
Species: Hu
Applications: WB, IHC, Block
NBP1-85818
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-01608
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC, IHC-P
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready
NBP2-57262
Species: Hu
Applications: ICC/IF

Publications for Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody (H00001138-M01) (0)

There are no publications for Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody (H00001138-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody (H00001138-M01) (0)

There are no reviews for Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody (H00001138-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody (H00001138-M01). (Showing 1 - 1 of 1 FAQ).

  1. I am looking to buy antibodies against most of the nicotinic receptor subunits for WB and IHC application. Could you please indicate which of your antibodies have been used by other researchers and provide publications showing their use? Thanks.
    • A list of our antibodies directed against he nicotinic acetylcholine receptors can be found here. Any products with publications will be indicated on the search page and can be found under the publications tab on the individual product's datasheet. Furthermore, we guarantee all of our products for the applications and species list on the datasheet. This should help narrow down your search.

Secondary Antibodies

 

Isotype Controls

Additional Nicotinic Acetylcholine R alpha 5/CHRNA5 Products

Bioinformatics Tool for Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody (H00001138-M01)

Discover related pathways, diseases and genes to Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody (H00001138-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody (H00001138-M01)

Discover more about diseases related to Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody (H00001138-M01).
 

Pathways for Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody (H00001138-M01)

View related products by pathway.

PTMs for Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody (H00001138-M01)

Learn more about PTMs related to Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody (H00001138-M01).

Blogs on Nicotinic Acetylcholine R alpha 5/CHRNA5

There are no specific blogs for Nicotinic Acetylcholine R alpha 5/CHRNA5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody (7D3) and receive a gift card or discount.

Bioinformatics

Gene Symbol CHRNA5
Entrez
OMIM
Uniprot