Recombinant Human NGFRAP1/BEX3/NADE Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human NGFRAP1/BEX3/NADE Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-101 of Human NGFRAP1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MEQPMQNGEEDRPLGGGEGHQPAGNRRGQARRLAPNFRWAIPNRQINDGMGGDGDDMEIFMEEMREIRRKLRELQLRNCLRILMGELSNHHDHHDEFCLMP

Protein/Peptide Type
Recombinant Protein
Gene
NGFRAP1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NGFRAP1/BEX3/NADE Protein

  • BEX3
  • BEX3p75NTR-associated cell death executor
  • Brain-expressed X-linked protein 3
  • DXS6984EX-linked 3
  • HGR74
  • NADE
  • nerve growth factor receptor (TNFRSF16) associated protein 1
  • Nerve growth factor receptor-associated protein 1
  • NGFRAP1
  • Ovarian granulosa cell 13.0 kDa protein HGR74
  • ovarian granulosa cell protein (13kD)
  • protein BEX3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB367
Species: Hu, Ca
Applications: WB, IHC, ICC
NBP2-33443
Species: Hu
Applications: IHC, IHC-P
NBP2-06797
Species: Hu
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NB110-74753
Species: Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-91702
Species: Hu
Applications: IHC, IHC-P
MAB224
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
NB110-40561
Species: Hu
Applications: WB, IP
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-18910
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF5789
Species: Hu, Mu, Rt
Applications: WB
AF1138
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP2-46234
Species: Hu
Applications: WB, IHC
NBP1-47897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56311
Species: Hu
Applications: WB, ICC/IF, IHC-P
H00027018-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for NGFRAP1/BEX3/NADE Recombinant Protein (H00027018-P01) (0)

There are no publications for NGFRAP1/BEX3/NADE Recombinant Protein (H00027018-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NGFRAP1/BEX3/NADE Recombinant Protein (H00027018-P01) (0)

There are no reviews for NGFRAP1/BEX3/NADE Recombinant Protein (H00027018-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NGFRAP1/BEX3/NADE Recombinant Protein (H00027018-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NGFRAP1/BEX3/NADE Products

Bioinformatics Tool for NGFRAP1/BEX3/NADE Recombinant Protein (H00027018-P01)

Discover related pathways, diseases and genes to NGFRAP1/BEX3/NADE Recombinant Protein (H00027018-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NGFRAP1/BEX3/NADE Recombinant Protein (H00027018-P01)

Discover more about diseases related to NGFRAP1/BEX3/NADE Recombinant Protein (H00027018-P01).
 

Pathways for NGFRAP1/BEX3/NADE Recombinant Protein (H00027018-P01)

View related products by pathway.

PTMs for NGFRAP1/BEX3/NADE Recombinant Protein (H00027018-P01)

Learn more about PTMs related to NGFRAP1/BEX3/NADE Recombinant Protein (H00027018-P01).
 

Research Areas for NGFRAP1/BEX3/NADE Recombinant Protein (H00027018-P01)

Find related products by research area.

Blogs on NGFRAP1/BEX3/NADE

There are no specific blogs for NGFRAP1/BEX3/NADE, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BDNF [Unconjugated]
248-BD-005/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NGFRAP1/BEX3/NADE Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NGFRAP1
Entrez