We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

NGFRAP1/BEX3/NADE Recombinant Protein Antigen

Images

 
There are currently no images for NGFRAP1/BEX3/NADE Protein (NBP1-89987PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

NGFRAP1/BEX3/NADE Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NGFRAP1.

Source: E. coli

Amino Acid Sequence: NEEMEQPMQNGEEDRPLGGGEGHQPAGNRRGQARRLAPNFRWAIPNRQINDGMGGDGDDMEIFMEEMREIRRKLRELQLRNCLRILMGELSNHHDHHDEF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
BEX3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89987.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NGFRAP1/BEX3/NADE Recombinant Protein Antigen

  • BEX3
  • BEX3p75NTR-associated cell death executor
  • Brain-expressed X-linked protein 3
  • DXS6984EX-linked 3
  • HGR74
  • NADE
  • nerve growth factor receptor (TNFRSF16) associated protein 1
  • Nerve growth factor receptor-associated protein 1
  • NGFRAP1
  • Ovarian granulosa cell 13.0 kDa protein HGR74
  • ovarian granulosa cell protein (13kD)
  • protein BEX3

Background

The p75 neurotrophin receptor (p75NTR) is a member of the tumor necrosis receptor superfamily and can mediate cell death and cell survival in response to nerve growth factor (NGF). The p75NTR-associated cell death executor (NADE) mediates apoptosis by interacting with the cell death domain of p75NTR following the binding of NGF by p75NTR. Recent studies have shown that NADE also interacts with second mitochondria-derived activator of caspase (Smac). Coexpression of NADE and Smac promotes TRAIL-induced apoptosis and inhibits XIAP-mediated Smac ubiquitization. It has been suggested that it is this interaction between NADE and Smac that allows apoptosis to proceed. Finally, although initially discovered as an mRNA expressed in ovarian granulosa cells, NADE has been suggested to play a role in the neuronal death seen in epileptic brain damage.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1157
Species: Mu
Applications: IHC, WB
NBP3-47861
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP2-06797
Species: Hu
Applications: WB
256-GF
Species: Hu
Applications: BA
DBD00
Species: Hu
Applications: ELISA
NB110-74751
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-84506
Species: Hu
Applications: WB
MAB224
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
MAB3468
Species: Hu
Applications: ICC, WB
H00001523-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
DRT200
Species: Hu
Applications: ELISA
NBP1-18910
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
H00003059-M02
Species: Hu
Applications: ELISA, IHC,  IHC-P, KD, PLA, S-ELISA, WB
AF1138
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut, WB
NBP2-46234
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
268-N4
Species: Hu
Applications: BA
NB100-56311
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for NGFRAP1/BEX3/NADE Protein (NBP1-89987PEP) (0)

There are no publications for NGFRAP1/BEX3/NADE Protein (NBP1-89987PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NGFRAP1/BEX3/NADE Protein (NBP1-89987PEP) (0)

There are no reviews for NGFRAP1/BEX3/NADE Protein (NBP1-89987PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NGFRAP1/BEX3/NADE Protein (NBP1-89987PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NGFRAP1/BEX3/NADE Products

Research Areas for NGFRAP1/BEX3/NADE Protein (NBP1-89987PEP)

Find related products by research area.

Blogs on NGFRAP1/BEX3/NADE

There are no specific blogs for NGFRAP1/BEX3/NADE, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NGFRAP1/BEX3/NADE Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol BEX3