NGFRAP1/BEX3/NADE Antibody Summary
| Immunogen |
NGFRAP1 (NP_996800.1, 1 a.a. - 101 a.a.) full-length human protein. MEQPMQNGEEDRPLGGGEGHQPAGNRRGQARRLAPNFRWAIPNRQINDGMGGDGDDMEIFMEEMREIRRKLRELQLRNCLRILMGELSNHHDHHDEFCLMP |
| Specificity |
NGFRAP1 - nerve growth factor receptor (TNFRSF16) associated protein 1, |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Mouse |
| Gene |
BEX3 |
| Purity |
Protein A purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence
- Western Blot 1:500
|
| Application Notes |
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. It has also been used for immunofluorescence. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
Protein A purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for NGFRAP1/BEX3/NADE Antibody
Background
The p75 neurotrophin receptor (p75NTR) is a member of the tumor necrosis receptor superfamily and can mediate cell death and cell survival in response to nerve growth factor (NGF). The p75NTR-associated cell death executor (NADE) mediates apoptosis by interacting with the cell death domain of p75NTR following the binding of NGF by p75NTR. Recent studies have shown that NADE also interacts with second mitochondria-derived activator of caspase (Smac). Coexpression of NADE and Smac promotes TRAIL-induced apoptosis and inhibits XIAP-mediated Smac ubiquitization. It has been suggested that it is this interaction between NADE and Smac that allows apoptosis to proceed. Finally, although initially discovered as an mRNA expressed in ovarian granulosa cells, NADE has been suggested to play a role in the neuronal death seen in epileptic brain damage.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Hu
Applications: WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
Species: Hu
Applications: ICC, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, KD, PLA, S-ELISA, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Publications for NGFRAP1/BEX3/NADE Antibody (H00027018-B01P) (0)
There are no publications for NGFRAP1/BEX3/NADE Antibody (H00027018-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for NGFRAP1/BEX3/NADE Antibody (H00027018-B01P) (0)
There are no reviews for NGFRAP1/BEX3/NADE Antibody (H00027018-B01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for NGFRAP1/BEX3/NADE Antibody (H00027018-B01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional NGFRAP1/BEX3/NADE Products
Research Areas for NGFRAP1/BEX3/NADE Antibody (H00027018-B01P)
Find related products by research area.
|
Blogs on NGFRAP1/BEX3/NADE