NGFI-B alpha/Nur77/NR4A1 Antibody (3L9T8) Summary
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NGFI-B alpha/Nur77/NR4A1 (P22736). MPCIQAQYGTPAPSPGPRDHLASDPLTPEFIKPTMDLASPEAAPAAPTALPSFSTFMDGYTGEFDTFLYQLPGTVQPCSSASSSASSTSSSSATSPASAS |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
NR4A1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:500 - 1:2000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for NGFI-B alpha/Nur77/NR4A1 Antibody (3L9T8)
Background
Nak1 is a member of the steroid/thyroid hormone receptor superfamily. The gene for Nak-1 is induced rapidly by androgens/growth factors and may have functions related to cell proliferation, differentiation and apoptosis (1). Liu et al (2) have demonstrated that mouse nur77 is necessary for induced apoptosis in T-cell hybridomas and can also be induced during early mitogenesis. Nak1 is a phosphoprotein and its size ranges from 67 kD to 88 kD, depending on post-translational modifications.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Hu
Applications: IP, WB
Species: Hu
Applications: ICC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Ce
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu
Applications: ICC, IHC, WB
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: WB
Publications for NGFI-B alpha/Nur77/NR4A1 Antibody (NBP3-15432) (0)
There are no publications for NGFI-B alpha/Nur77/NR4A1 Antibody (NBP3-15432).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for NGFI-B alpha/Nur77/NR4A1 Antibody (NBP3-15432) (0)
There are no reviews for NGFI-B alpha/Nur77/NR4A1 Antibody (NBP3-15432).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for NGFI-B alpha/Nur77/NR4A1 Antibody (NBP3-15432) (0)